KEGG   Drosophila sechellia: Dsec_GM26707Help
Entry
Dsec_GM26707      CDS       T01064                                 

Definition
GM26707 gene product from transcript GM26707-RA
Orthology
K11252  
histone H2B
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaacatc
accaagaacgacaagaaaaagaaacgcaagaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacacaggaatttcgtcgaaggcgatgagcataatg
aacagctttgtaaatgatattttcgagcgaattgctgccgaagcgtctcgtctagctcac
tacaacaagcgctcgaccatcaccagtcgggaaatccaaacggctgttcgcctgcttctg
cctggagagttggccaagcatgctgtcagtgagggaaccaaggctgttaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system