KEGG   Drosophila sechellia: Dsec_GM26765Help
Entry
Dsec_GM26765      CDS       T01064                                 

Definition
GM26765 gene product from transcript GM26765-RA
Orthology
K15293  
protein unc-13
Organism
dse  Drosophila sechellia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 288 aa AA seqDB search
MRRFAKTIVKVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLE
EDAANILKELQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSVKGGSGTLAAGNLA
AQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPP
MTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLS
PKQCAVLDVALDTIKQYFHAGANGLKKTFLEKSPELQSYVTHSVYIHK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgttttgctaaaacaatcgtaaaagtgctaatagcctatgcggatattgtgaaa
cttgagtttccagagcatatgaaggatgaaagaattgcttgcatacttatgaacaacatt
cagcaactaagggtgcagctagaaaaaatgtttgagtctatgggtggggataagctagag
gaagatgcagccaatattttgaaagaactacagcaaaatcttaactctgcgttggacgac
ttagcttcacaattcgctatcagtttggagccacgaataactcaatcagtgcgagaactt
ggagacatgctgctttctgttaagggaggcagtggaacccttgctgctggtaatcttgca
gctcaaaggaacgcggtcgccgttgaggccgatgaagttttaaggccgcttatggattta
cttgatggctctttaactctctatgcgcaatcatgtgaaaaaaccgtgctaaagaggtta
ctaaaggagttatggaagatcgtaatgcgaatattagagaaaacaattgttttaccacct
atgactgataaaactatgatgtttaaacaccttactgacaatgcaaaaaacttggcatcc
aatgcaaaaattgaagacatgggtcgtttgttcaagtcacatatggcaggaaaacaggat
gttaagagtgctctgagcggggtaatggacatatcaaaagaagttgaaaaaaacttgtca
cccaagcaatgcgcagtgcttgacgttgcattagatacaataaaacaatactttcacgcg
ggtgccaatggactgaaaaagacatttctcgaaaagtcgcccgagcttcagagttacgtt
acgcactcagtttatatacacaaatga

DBGET integrated database retrieval system