KEGG   Desulfocapsa sulfexigens: UWK_01179Help
Entry
UWK_01179         CDS       T02473                                 

Definition
(GenBank) alcohol dehydrogenase, class IV
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00010  Glycolysis / Gluconeogenesis
dsf00071  Fatty acid degradation
dsf00350  Tyrosine metabolism
dsf00620  Pyruvate metabolism
dsf00625  Chloroalkane and chloroalkene degradation
dsf00626  Naphthalene degradation
dsf00650  Butanoate metabolism
dsf01100  Metabolic pathways
dsf01110  Biosynthesis of secondary metabolites
dsf01120  Microbial metabolism in diverse environments
dsf01130  Biosynthesis of antibiotics
dsf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UWK_01179
   00620 Pyruvate metabolism
    UWK_01179
   00650 Butanoate metabolism
    UWK_01179
  Lipid metabolism
   00071 Fatty acid degradation
    UWK_01179
  Amino acid metabolism
   00350 Tyrosine metabolism
    UWK_01179
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UWK_01179
   00626 Naphthalene degradation
    UWK_01179
Enzymes [BR:dsf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UWK_01179
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     UWK_01179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AGF77747
UniProt: M1P7S2
Position
complement(1321923..1324511)
Genome map
AA seq 862 aa AA seqDB search
MFQPDSSNLTDAEQVDEIIFQAMSAQDAYLQINQQSIDRIVHFMAEVGESQHLALAKLAV
KESARGIVEDKSVTNIFASNGLDQKLRNIHSVGPLEDNEINKYQIITEPVGTLASFPSPE
HPTANVLFQAIISVKTRNPIVFCFHPSVQSSSKAAANLMQQAAQDAGAPPYAIQWLPSGS
ESSINALASHPDISLILMDENASVLSALQSLPNTPILGNGQINTPCFIHRSADIEQAVTD
VIASRHFDNGLIPSSEQTLIISREIYFQTVDLLMQKSCHLASEQEKTQLEELLFDQETGL
PNSDCTGMDAVVIAKMAGFTVPPHTKLLLTEIGGIGPSYPLSGSNAAPVLSILAAESWYE
GLCFCEAVLEFGSTSHTAVLHARDTDLCDEFSTRLRASHIVLNQPATDGDLCRLLVISGN
SVTSAEDRQVGNPATAGLSMDMLLRRKLLQKQNTRIREWKTPGNVLFAKGCSNHLRTLPE
VARTLIVTEKELLESDHIDAVLNHLSDQKYPVKTEFFCKTNRVVTVSSIEEGIQCMNRFR
PTAILAIGNGATIDTAKAIRYFYQRPDNSLPYSSPNPEHANSSGSLSNPPQRRVSLIAMP
TTPRAGFKINALITIFDNRLEKRQNIHSCELLPDTTLIDPDFSTPLSAKEMAITGMTILS
HALEAYVSPLASDYSDSMAIKAILIIFDYLPMAVTRNQISTREKLYNAATMAGMATGNAK
PGLAHAMAHSLSSAFNLTHGQAHSLLLPSIVRYNGVEDPSRFNPLMPGSRYIAHERYQEI
AKSLGLACKSPEQGVDSLVKAISRMQRELHLPCTIREYNISQKEYLGITEQMAEQAFTDH
STTTNPRLPLISEIIDIFDDIY
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagccagacagttcaaacctgacagatgcagaacaggttgatgaaataatcttt
caggccatgtccgcacaggacgcctatctccagattaatcaacagtccatagacagaatc
gtccattttatggcagaggttggggaatcgcaacacctggctcttgctaaactcgctgta
aaggaatcggcaagaggtattgttgaggacaaatccgttacgaacatatttgcctcaaat
ggtttggatcaaaaactgcgaaatatacactccgttggtcctcttgaagataacgaaata
aacaagtaccagattattacagaaccagtcggaacactggcgtcttttccttccccggaa
catccgacggcgaacgtactcttccaggcaatcatcagtgtgaaaacccgtaaccccatc
gtattctgtttccacccgtcggtacaatcctcttccaaagctgcagcaaacctcatgcaa
caggcagcacaggacgcaggtgcaccgccatatgccatccagtggctgccatcaggatcg
gaaagcagtatcaatgcccttgccagccatcccgatatcagccttattcttatggatgaa
aacgcctctgtcctctccgctctccaatcgctacccaatacccccatacttggtaacgga
cagataaacaccccgtgttttattcaccgttcagcagatatcgagcaggcagtaaccgat
gtgattgcatccagacatttcgacaacggcctgattccatcttcagaacagacccttatt
atcagccgggaaatttattttcaaaccgttgacctgctgatgcagaaatcctgccacctg
gcttcggagcaagaaaaaacgcagctggaagagctcctttttgatcaggaaacaggcctt
ccaaattcggattgtacaggaatggatgcagttgtgatagccaaaatggcagggtttaca
gtcccgccccacaccaaattgctcctcactgaaatcggaggcattggcccctcctatccc
ctatcagggagcaacgctgctcctgtgctttccattctggcagccgagagctggtatgaa
ggactctgtttctgtgaagccgtacttgaatttggatccacctctcacaccgcagtcctc
catgccagagatactgatctctgcgatgaattttccacacggctgcgcgcaagccacatt
gtcctgaatcaacccgccaccgatggcgacctatgcagactgctggtaatatcgggtaac
agcgtcacctccgccgaagacagacaggtcggtaatcctgccactgcaggactttccatg
gacatgcttcttcgacgcaaactgctccagaaacaaaacactcgaatcagggaatggaaa
acaccaggaaacgtcctttttgcaaaggggtgcagcaaccacctccgaaccctcccggag
gttgcacgaaccctgattgtaactgaaaaagaacttcttgaaagcgaccatattgacgct
gttcttaatcacttaagcgatcagaagtatccggttaaaacagagtttttctgcaaaacc
aatcgcgtggtcacagtttcctccatcgaggaaggaatacagtgcatgaacaggtttcgg
cctaccgcaatccttgccattggcaatggggctaccatcgacacagcaaaggccatacgt
tatttttaccaacgacctgacaactcactgccatactcctccccaaatccagagcacgcg
aactcctccggatctctttcaaatccgccacaacgacgggtttctctcattgccatgcca
accacaccacgagccggttttaaaataaacgccttaattaccatttttgataatcgcctg
gaaaagcgccaaaatattcactcatgtgagctgctccctgacaccacccttattgacccg
gatttttccacccctctaagtgctaaagagatggcgattaccggtatgaccattctcagc
catgctcttgaagcctatgtttctcctctggcatcggactactccgactccatggccata
aaagccatcctgataatctttgattacctgccaatggctgttacccgcaatcagatcagt
accagagaaaaactctacaacgctgctaccatggccggaatggccaccggaaatgcaaaa
ccgggacttgcccatgccatggcccactctctcagttcggcattcaacctgactcatggc
caggcacacagcctcttgcttcccagtattgttcgctacaatggagtggaagaccccagt
cgttttaaccccctcatgcccggaagcaggtatattgctcatgagcgctatcaggaaatt
gccaaaagcctgggacttgcctgtaaaagtcctgaacagggcgttgattccctggtgaaa
gccatcagccgtatgcagcgggagctgcatctgccatgtacaatccgtgaatacaatatc
agtcagaaggaatatctgggaataactgaacagatggcggaacaggcatttaccgaccat
tccaccacaacaaacccccgcctaccactaatatctgagattattgacatatttgacgat
atctattaa

DBGET integrated database retrieval system