KEGG   Desulfocapsa sulfexigens: UWK_01179Help
Entry
UWK_01179         CDS       T02473                                 

Definition
alcohol dehydrogenase, class IV (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    UWK_01179
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UWK_01179
   00620 Pyruvate metabolism
    UWK_01179
   00650 Butanoate metabolism
    UWK_01179
  Lipid metabolism
   00071 Fatty acid degradation
    UWK_01179
  Amino acid metabolism
   00350 Tyrosine metabolism
    UWK_01179
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UWK_01179
   00626 Naphthalene degradation
    UWK_01179
Enzymes [BR:dsf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UWK_01179
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     UWK_01179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1321923..1324511)
Genome map
AA seq 862 aa AA seqDB search
MFQPDSSNLTDAEQVDEIIFQAMSAQDAYLQINQQSIDRIVHFMAEVGESQHLALAKLAV
KESARGIVEDKSVTNIFASNGLDQKLRNIHSVGPLEDNEINKYQIITEPVGTLASFPSPE
HPTANVLFQAIISVKTRNPIVFCFHPSVQSSSKAAANLMQQAAQDAGAPPYAIQWLPSGS
ESSINALASHPDISLILMDENASVLSALQSLPNTPILGNGQINTPCFIHRSADIEQAVTD
VIASRHFDNGLIPSSEQTLIISREIYFQTVDLLMQKSCHLASEQEKTQLEELLFDQETGL
PNSDCTGMDAVVIAKMAGFTVPPHTKLLLTEIGGIGPSYPLSGSNAAPVLSILAAESWYE
GLCFCEAVLEFGSTSHTAVLHARDTDLCDEFSTRLRASHIVLNQPATDGDLCRLLVISGN
SVTSAEDRQVGNPATAGLSMDMLLRRKLLQKQNTRIREWKTPGNVLFAKGCSNHLRTLPE
VARTLIVTEKELLESDHIDAVLNHLSDQKYPVKTEFFCKTNRVVTVSSIEEGIQCMNRFR
PTAILAIGNGATIDTAKAIRYFYQRPDNSLPYSSPNPEHANSSGSLSNPPQRRVSLIAMP
TTPRAGFKINALITIFDNRLEKRQNIHSCELLPDTTLIDPDFSTPLSAKEMAITGMTILS
HALEAYVSPLASDYSDSMAIKAILIIFDYLPMAVTRNQISTREKLYNAATMAGMATGNAK
PGLAHAMAHSLSSAFNLTHGQAHSLLLPSIVRYNGVEDPSRFNPLMPGSRYIAHERYQEI
AKSLGLACKSPEQGVDSLVKAISRMQRELHLPCTIREYNISQKEYLGITEQMAEQAFTDH
STTTNPRLPLISEIIDIFDDIY
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagccagacagttcaaacctgacagatgcagaacaggttgatgaaataatcttt
caggccatgtccgcacaggacgcctatctccagattaatcaacagtccatagacagaatc
gtccattttatggcagaggttggggaatcgcaacacctggctcttgctaaactcgctgta
aaggaatcggcaagaggtattgttgaggacaaatccgttacgaacatatttgcctcaaat
ggtttggatcaaaaactgcgaaatatacactccgttggtcctcttgaagataacgaaata
aacaagtaccagattattacagaaccagtcggaacactggcgtcttttccttccccggaa
catccgacggcgaacgtactcttccaggcaatcatcagtgtgaaaacccgtaaccccatc
gtattctgtttccacccgtcggtacaatcctcttccaaagctgcagcaaacctcatgcaa
caggcagcacaggacgcaggtgcaccgccatatgccatccagtggctgccatcaggatcg
gaaagcagtatcaatgcccttgccagccatcccgatatcagccttattcttatggatgaa
aacgcctctgtcctctccgctctccaatcgctacccaatacccccatacttggtaacgga
cagataaacaccccgtgttttattcaccgttcagcagatatcgagcaggcagtaaccgat
gtgattgcatccagacatttcgacaacggcctgattccatcttcagaacagacccttatt
atcagccgggaaatttattttcaaaccgttgacctgctgatgcagaaatcctgccacctg
gcttcggagcaagaaaaaacgcagctggaagagctcctttttgatcaggaaacaggcctt
ccaaattcggattgtacaggaatggatgcagttgtgatagccaaaatggcagggtttaca
gtcccgccccacaccaaattgctcctcactgaaatcggaggcattggcccctcctatccc
ctatcagggagcaacgctgctcctgtgctttccattctggcagccgagagctggtatgaa
ggactctgtttctgtgaagccgtacttgaatttggatccacctctcacaccgcagtcctc
catgccagagatactgatctctgcgatgaattttccacacggctgcgcgcaagccacatt
gtcctgaatcaacccgccaccgatggcgacctatgcagactgctggtaatatcgggtaac
agcgtcacctccgccgaagacagacaggtcggtaatcctgccactgcaggactttccatg
gacatgcttcttcgacgcaaactgctccagaaacaaaacactcgaatcagggaatggaaa
acaccaggaaacgtcctttttgcaaaggggtgcagcaaccacctccgaaccctcccggag
gttgcacgaaccctgattgtaactgaaaaagaacttcttgaaagcgaccatattgacgct
gttcttaatcacttaagcgatcagaagtatccggttaaaacagagtttttctgcaaaacc
aatcgcgtggtcacagtttcctccatcgaggaaggaatacagtgcatgaacaggtttcgg
cctaccgcaatccttgccattggcaatggggctaccatcgacacagcaaaggccatacgt
tatttttaccaacgacctgacaactcactgccatactcctccccaaatccagagcacgcg
aactcctccggatctctttcaaatccgccacaacgacgggtttctctcattgccatgcca
accacaccacgagccggttttaaaataaacgccttaattaccatttttgataatcgcctg
gaaaagcgccaaaatattcactcatgtgagctgctccctgacaccacccttattgacccg
gatttttccacccctctaagtgctaaagagatggcgattaccggtatgaccattctcagc
catgctcttgaagcctatgtttctcctctggcatcggactactccgactccatggccata
aaagccatcctgataatctttgattacctgccaatggctgttacccgcaatcagatcagt
accagagaaaaactctacaacgctgctaccatggccggaatggccaccggaaatgcaaaa
ccgggacttgcccatgccatggcccactctctcagttcggcattcaacctgactcatggc
caggcacacagcctcttgcttcccagtattgttcgctacaatggagtggaagaccccagt
cgttttaaccccctcatgcccggaagcaggtatattgctcatgagcgctatcaggaaatt
gccaaaagcctgggacttgcctgtaaaagtcctgaacagggcgttgattccctggtgaaa
gccatcagccgtatgcagcgggagctgcatctgccatgtacaatccgtgaatacaatatc
agtcagaaggaatatctgggaataactgaacagatggcggaacaggcatttaccgaccat
tccaccacaacaaacccccgcctaccactaatatctgagattattgacatatttgacgat
atctattaa

DBGET integrated database retrieval system