KEGG   Desulfocapsa sulfexigens: UWK_01610Help
Entry
UWK_01610         CDS       T02473                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UWK_01610
Enzymes [BR:dsf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     UWK_01610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1804753..1806147)
Genome map
AA seq 464 aa AA seqDB search
MKKDTLIIGAGLSGLTVAWKLKQIPGHSILLLEQSDRAGGAISSHAESGYIAEGGPHGFL
DNCLESQTLLRETGLDKECLKAPLSQFVRYVCMDATLRLIPQSPLKILAAPLISPLAKLR
VAGDFFKKPLQGEPTVGEWVKYRFGKALLPYVDAVFTGTYAGDLERLVIDGVMPGVRKIE
QEHGSVIYGLLKKMKAGKKAKQPGKKKGLPAMTSFPTGMGRLAERLYENLSNDEIHRNCP
ATRISRNSNGWEVTTAETTYSCRNLVLALPVNASLSLLANSVTAAPVATIPEARIVTIAM
GFGQEAHIPPGFGYLAPEREQRFCLGALFSSNMFPGRAPKDHILLEALIGGRRHPERLEL
DDDTLIQKAVQDLQQLLNLPQPPEYARVLRSPWGIPQLEKGYPALLKWRNTIMKEEKGLY
VTGFGWEGIGLNDMIKTAFRVSEAIRQGEQDDGEDNAEVKKVYF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagatacgctgatcatcggagccgggctttcagggctgacggttgcctggaaa
ctgaaacagatcccgggccattccattctcctgctcgaacagtctgacagagcaggaggt
gctatctccagccatgcagagtccggttacattgccgagggtggccctcacggattcctc
gacaactgtctggaatcgcagacgctcctcagagaaacaggacttgacaaagagtgcctc
aaggcacctctttcccagtttgttcgctatgtctgcatggatgccacactcagactcatc
ccccaatcaccgctgaaaattcttgcagccccacttatctctcctctcgccaagctgcgc
gttgccggcgactttttcaagaaacctttgcagggtgagcccacggtaggtgaatgggtt
aaataccgttttggcaaagcattactcccctacgttgacgcagtttttacaggaacctac
gcaggagatctggaacgactggttattgatggcgtgatgcccggagtacgcaagattgag
caggagcatggctccgtcatctacggtctgttaaaaaagatgaaggcaggaaaaaaggca
aagcaacctgggaaaaagaagggccttcccgccatgaccagttttcctaccggcatgggg
agattggcggagcgcctatacgaaaatttaagcaatgacgagatacacagaaactgtcct
gcaacacgaatttcacgaaacagcaacggctgggaagtgacaacggcagagacaacctat
agctgccgtaatcttgtgctggcactgcccgtcaacgcgtctctttctcttctagcaaat
agtgttacagcagcaccagttgcaacaatccccgaagcccgaattgtcaccattgccatg
ggttttggccaggaagcacatatccccccaggttttggttatctggcaccggaacgggaa
cagcggttttgccttggggcacttttctcctccaacatgtttccaggtcgtgccccaaag
gaccatattctgctggaagcactgattggaggacgtagacaccccgaacgccttgaactc
gacgatgacacattgattcaaaaggcagtgcaggatttacagcaactcctgaaccttccc
caaccgccagaatacgccagagtccttcgctcgccttggggaatcccacaactggaaaag
gggtaccccgcacttctcaaatggcgcaatacaataatgaaagaagaaaaggggctgtat
gttacaggatttggatgggaaggtattgggcttaacgatatgatcaaaaccgcctttcgc
gtgagtgaggcaatcaggcagggcgaacaggatgatggagaagataacgctgaagtgaaa
aaggtctacttctag

DBGET integrated database retrieval system