KEGG   Desulfocapsa sulfexigens: UWK_02733Help
Entry
UWK_02733         CDS       T02473                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dsf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3045838..3047409)
Genome map
AA seq 523 aa AA seqDB search
MPTTQYRRASGILAHISSLPSPHGIGDIGISSYNFISFLKDAGQTLWQFLPTGPTNPIFD
NSPYMSTSAFAGSPLLISLDLLVADGLLQDHEINVPQFSEYQTVYKEVALFKNNCLQLAF
NNFDRTTNNSAFTKFKQSTVWLKDYCLFMTLKEVFHQKGWFDWPSKLAHRDKAAMEEVTD
KYSARMDYFAFEQFVFFKQWQELRKLANSMNIQLIGDIPIYVGWDSVDVWANQAIFSLDP
ETLHPTEVAGVPPDYFSKTGQRWGNPLYRWNSTDKVVKNQLYSWWTERFRSLFQMVDVAR
VDHFRGFEAYWSIPASHKTAMNGEWIKGPGIHFFEEIYKNLGPLNIIAEDLGEITPEVLA
LRDALDFPGMKILQFAFDGNKENSFLPFNFDTPNSVIYTGTHDNDTTVGWFLSNHLSESG
RSELRAFCNNRTNNDSDIHRDLIYLALSSISRYAIFPLQDVLGFGNDCKMNSPGSKEGNW
AWRCAPRFLTQDISNWLSRQCELFGRRPAQPSITNHTEGAEKQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaactcaatacagacgcgcaagtggaattctcgcccatatttcttctcttcct
tcaccccatggaattggcgacattggcatatcttcttataattttataagcttcctaaaa
gacgctggtcagacgctatggcaatttctgccaacaggcccgacaaatccgatattcgac
aactccccttacatgagcacctccgcctttgccggatctccgttgcttatttctcttgat
ttgcttgttgcagacggtcttctccaagaccatgagataaacgttccacaattttccgaa
taccaaactgtttataaagaagtagcactcttcaaaaacaactgccttcagctcgccttc
aataattttgaccgcacaaccaacaattccgcttttacaaaattcaaacaatccacagta
tggctgaaagactactgtctgtttatgactctaaaggaggtcttccaccagaaagggtgg
tttgactggcccagcaaacttgcccatcgcgacaaagccgccatggaggaagtgactgac
aagtattctgcacgtatggattattttgcttttgaacaatttgttttttttaaacagtgg
caagaacttcgaaaacttgcaaatagcatgaacattcagctcattggcgatatcccgatc
tatgttggttgggatagcgttgatgtctgggctaatcaggctatattttccctcgaccca
gagactctgcacccaacagaggttgcaggcgtccctcctgattatttttcaaaaaccggt
cagcgctggggcaacccactttatcgttggaatagcaccgataaagtggttaaaaatcag
ctatactcctggtggacggaacgcttccgttctcttttccagatggtggacgttgcccgg
gttgatcattttcgtggatttgaagcctactggtccattccagccagccacaaaactgca
atgaatggcgaatggataaaaggaccaggtattcatttttttgaagaaatctataaaaac
cttggacctctgaatatcattgctgaggatctcggagagatcacccctgaggttcttgct
ctgcgtgatgctcttgattttcccggaatgaaaattcttcagtttgcctttgatggcaac
aaggagaacagtttcctcccctttaacttcgacaccccaaacagcgttatttacacagga
acacatgataacgacaccaccgttggctggttcctgagcaatcacttaagcgaatccgga
cgaagcgaacttcgggcattttgcaacaacaggacgaataatgactccgacatacataga
gatttgatctatcttgcactttcatcaatcagtcgctacgccatttttcctcttcaggat
gttctcggttttggcaatgactgcaagatgaacagccccgggagtaaagagggcaactgg
gcctggcgctgtgctcctcgttttttaacccaggacatctccaactggctcagcagacag
tgtgaactcttcggacgacgccctgctcaaccgtcaatcaccaaccacacagagggggct
gaaaaacagtga

DBGET integrated database retrieval system