KEGG   Desulfocapsa sulfexigens: UWK_02810Help
Entry
UWK_02810         CDS       T02473                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
dsf00330  Arginine and proline metabolism
dsf00332  Carbapenem biosynthesis
dsf01100  Metabolic pathways
dsf01130  Biosynthesis of antibiotics
dsf01230  Biosynthesis of amino acids
Module
dsf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dsf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    UWK_02810
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    UWK_02810
Enzymes [BR:dsf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     UWK_02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGF79341
UniProt: M1PSN4
Position
3128107..3129273
Genome map
AA seq 388 aa AA seqDB search
MNENNTEISLEDGLFLRQTYFDKAKRIVVKVGSAVLTDEKGIDTNIIQNIARELSFLKKS
GREVILVSSGAVAAGKRKITIPDNVEIGIEEKQALAAIGQPVLMQSYEAAFEECGQVVAQ
VLLTHSDLANRKRYLCVRNTILALFRFDAIPILNENDTVAVDELRFGDNDTLAALIANLI
EADMFICLTDVVGLYTGNPQTDSDARQLYTVAAVTKEIESMAGNVKSALGTGGMRSKIRA
AKMVSSGGGSSFIGPGRNPQILQQLFSGEMVGTFFLPAQDKIKPRKQWIAHVLHPRGFLM
LDAGACRAISANGCSLLPSGIQEIRGDFGVGDAVHCIDPDGKVIAAGLINYCSSDVAKIK
QHRSDEISNLLGTKDYDEVIHRDNLVLL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaataataccgaaattagcctggaagatggcctttttctacgccaaacgtat
tttgacaaggcaaaacgaattgttgtaaaggtcggctctgcagtgctcaccgatgagaaa
ggtattgatacaaatatcattcaaaatattgctcgtgaattgagctttctcaaaaaaagt
ggtcgggaagttatccttgtgagctctggagctgttgctgccggaaagcgtaaaattacc
attcctgataatgtcgaaataggaattgaagagaaacaggcacttgcggctattggccag
cccgttcttatgcaatcctatgaggcagcttttgaggagtgtggtcaagttgtggctcaa
gtactgcttacccactctgatcttgccaatcgtaagcgctacctctgtgtccgcaatacc
atcctcgcactttttcggtttgatgcaatccccatcctcaatgaaaacgataccgttgct
gttgatgaactccgttttggagataacgacacacttgcggctttaattgcaaatctcatt
gaagcggacatgtttatttgtctcacggatgtggttggtttgtatacagggaatccccag
acagattcagatgctcgacagctatatactgtggctgccgtaactaaagaaattgaatcc
atggcaggtaatgtcaaaagtgcacttggaaccggtgggatgcggtctaaaatacgggcc
gccaaaatggtttcttctggaggagggtcttcttttattgggccaggacgtaatccacaa
attttacaacagctctttagcggtgagatggtaggtactttttttctacctgcccaggat
aaaataaaaccacgaaaacaatggattgctcatgtattgcaccccaggggctttctgatg
cttgatgctggcgcttgtagagcgatatctgccaatggctgtagtctccttccatccggg
atccaggagattcgtggggacttcggagtgggcgatgctgttcactgcattgatcctgat
ggtaaagttattgcggcgggtcttatcaattactgctcctccgatgttgcaaaaataaaa
caacaccgttccgatgaaatatcgaatttacttgggacgaaagattatgatgaagttatt
caccgtgataatctcgtattactttaa

DBGET integrated database retrieval system