KEGG   Desulfocapsa sulfexigens: UWK_03180Help
Entry
UWK_03180         CDS       T02473                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dsf  Desulfocapsa sulfexigens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dsf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UWK_03180
Enzymes [BR:dsf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     UWK_03180
Exosome [BR:dsf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UWK_03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3537063..3539270
Genome map
AA seq 735 aa AA seqDB search
MGIKEQIDRLLLAEHYDPFQVLGVHFSDNDKDSAVIRCFQPHARSVSLLIDGKTIPMERV
RSEGIFEATIDRGTVTDENLDPYTYQYKITYNDGVEKTINDPYRFMPILSEEDRFLFNFG
TNYELYDHIGAHPGMYSQIRGTIFRVWAPSATRVSVLGNFNGWDGRVHPMRSLGSSGIWE
LFLPGIGEDEIYKFEIRTTRGDILEKSDPFQFFGEHRPKTASVVRYLDHYQWHDRDWQQS
KKEANPYENAMTIYELHPGSWQRDPSNPERFLTFRELADRLIPYVKKLGFTHIELMPVME
HPLDESWGYQITGPFSMTSRYGVPEDFMHFVDSCHLEGLGVILDWVPAHFPKDSHSLARF
DGTALFEHEDPRKGAHPEWGTFIYNYGRKEVSNFLIANALFWIDKYHIDGLRVDAVASML
YLDYSRKEGEWLPNQHGGRENLEAIEFIKHLNSVVYERHPGTLMIAEESTSFYGVSKPAD
QGGLGFGFKWNMGWMNDILAYFEKDCFYRRFHHNSLTFSIMYAFSENFILPLSHDEVVHG
KRSLIDKMPGDLWQKFANLRLLYLTMWMHPGKKLLFMGGEFGQWREWNCKQSLDFHLLHE
NDHHKAMLHFFHELNTLYKSNASLWELDFSPDGFQWMDLEDRENSIISYARFAKNRDDHL
VCLLNFTPQTFYNYKIGLPSGSNYEQVFCSDQSRFGGSNAADRTIYRTIDEPYAQAQFHA
NVTVPPLAGIVLKPC
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgggaataaaagaacaaatagatcgcctcctccttgcagaacattatgatccttttcag
gttctgggggtacatttttctgacaacgataaggattcagccgttattcgctgctttcag
ccccacgccaggtctgtttcactcctgattgatgggaaaaccattccgatggaaagagtg
cgtagtgaggggatttttgaagccaccattgatcggggtacggttaccgacgaaaacctt
gatccttacacctatcaatataaaatcacttataacgatggtgtagaaaaaacgatcaat
gatccttatcgttttatgccaatcctgagtgaggaggacaggttcctctttaattttggc
accaattatgaactctacgaccatatcggtgctcaccccggcatgtattcccagatcagg
ggaaccatttttcgcgtatgggccccatcagccaccagagtttccgtgctcggcaacttc
aatggctgggacggcagggttcatcccatgcgaagtcttggcagttcagggatatgggaa
ctttttcttcccggaattggtgaggatgaaatctataaatttgagattcgcaccacccgg
ggtgatatcctggaaaaatctgatccatttcaattttttggcgaacatcggccaaaaacc
gcatcggtggttcgctatctcgatcattatcaatggcatgacagggattggcaacaatca
aaaaaagaagccaacccctatgaaaatgccatgaccatttacgagctccaccccggatcc
tggcaacgcgatccttcaaaccctgaacgttttctcaccttcagagagctggcagacaga
ctcatcccctatgtgaagaaactcggatttacccacatcgaacttatgccggtaatggaa
catcccctggacgaatcatggggataccagattaccggtccattcagcatgaccagccgc
tatggtgttcctgaagactttatgcattttgtagacagttgccaccttgaaggtcttgga
gtcattctcgattgggttcctgctcattttcctaaggactcacacagtctcgcccgcttt
gacggcacagcactttttgaacatgaagacccaagaaagggtgcccatcctgagtggggt
acttttatttataattatggtcgtaaagaagtcagcaattttcttattgccaatgcccta
ttctggatagacaaataccatattgacggcctgcgtgttgatgccgtagcatccatgctg
tatctggattactcgcgtaaagaaggagagtggctccctaatcagcacgggggaagagaa
aaccttgaagcaattgaatttatcaaacatctgaactcagttgtttatgagcgtcaccct
ggcaccttgatgattgcagaggaatccaccagcttttacggagtttcaaaacctgccgat
cagggtgggctcggatttggcttcaaatggaatatgggctggatgaatgacatccttgcc
tactttgaaaaagattgtttctaccgacggtttcaccataacagtctaactttttccatt
atgtacgctttttctgaaaactttatcctgccgctctctcacgacgaagttgtccatgga
aaacgttctcttatcgacaaaatgcccggagatctctggcagaagtttgccaatcttcgt
cttctctacctgacaatgtggatgcaccccggcaaaaaacttctttttatgggaggggaa
tttggacaatggcgtgagtggaactgtaaacaaagcctggatttccacctgctccacgaa
aatgaccatcacaaagcaatgctccacttcttccatgaactcaacacactgtacaagagc
aatgcaagcctttgggaactcgatttcagccccgatggatttcaatggatggacctggag
gatcgagaaaattcaattatatcctatgcacgtttcgctaaaaatcgtgacgatcatctg
gtctgtcttctcaatttcaccccccagaccttttataactataaaataggactgccgagc
ggatccaactacgaacaagtcttctgctccgaccagagcagatttggcggaagcaatgca
gcagacaggacaatctacagaaccattgatgaaccctacgcccaggcacagtttcatgca
aatgtaacagttcctccccttgccgggattgttttgaaaccatgttaa

DBGET integrated database retrieval system