KEGG   Dinoroseobacter shibae: Dshi_0192Help
Entry
Dshi_0192         CDS       T00612                                 

Gene name
hppk
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dsh  Dinoroseobacter shibae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dshi_0192 (hppk)
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Dshi_0192 (hppk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
192409..192978
Genome map
AA seq 189 aa AA seqDB search
MKIQSFGIIALGANQPLGGRTPKVTLRQACEALADAPLEIVARSRFFATPAFPDPSQPEY
VNGCVTVETGLGAKALLKVLHDVEDRLGRARGQRWGARTLDLDLLALGAQVLPDMETYAQ
WRDLPRSAQVARTPNELILPHPRIADRPFVLVPLMDVAPLWRHPVTGKTASEMLRNLPKS
EIDAIRPLE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcagtcattcggcataattgcgcttggcgcaaatcagcccctcggcgggcgc
acgcccaaggtgaccttgcgtcaggcctgcgaggcgttggcggacgcgccgttggaaatc
gttgcgcgcagccgatttttcgccacgcccgcgtttccggatccgtcgcaaccggagtat
gtcaatggctgtgtgaccgtggaaaccgggctcggtgccaaggcgcttctgaaggtgttg
cacgatgtggaggacaggcttggccgtgcgcgcgggcagcggtggggcgcccggacgctg
gacctcgatctgctggcgctgggggcgcaggtcttgccggacatggagacctatgcccag
tggcgcgacctgccgcgcagcgcgcaggtggcgcgcacgccgaatgagttgattctcccc
catccgcggatcgcggaccggcccttcgttctggtgccgctgatggatgtcgcaccgctc
tggcggcacccggtgactggcaaaacggcctcggaaatgcttcggaacctgccgaaatcg
gaaatagatgccattcgaccgcttgagtaa

DBGET integrated database retrieval system