KEGG   Dinoroseobacter shibae: Dshi_0523Help
Entry
Dshi_0523         CDS       T00612                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dsh  Dinoroseobacter shibae
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dsh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
508203..508898
Genome map
AA seq 231 aa AA seqDB search
MTPATPLPDTTATRQALIDACLWMNARHLNQGTSGNISARIASGILITPSGVPYEYLTPD
ALVTIPLDGLPDSNGAQPSSEWPFHQGMHQARPDMPVVLHAHPPYCSVLAVQRRSIPACH
YMIAAFGGNDVPLADYALFGSPELCANMARIMADRHGCLMANHGATVLGETVDKARWRLE
ELETLARTYLFSSIGGAPHILSDAEIAEVMVAFSSYGPRHPEERNGEGERS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgcaaccccgctgccagatacgaccgccacgcggcaggcgctgatcgatgct
tgcctctggatgaacgcacgacatctcaaccaggggacgtcaggcaatatttcggcgcgt
atcgccagcggtatcctgatcaccccgtcgggtgtgccctatgaatacctgacacccgac
gctttggtcacgatcccgctggacggattgcccgacagcaacggtgcgcaaccatcatct
gaatggccgtttcatcagggaatgcaccaggcgcgcccggacatgccggtggtgctgcat
gcgcatccgccctattgcagcgtccttgcagtgcagcgccgatcgatcccggcctgccac
tacatgatcgcagccttcggcggcaatgatgtgccccttgccgattacgcacttttcggc
agccctgaactgtgcgcaaacatggcacgcatcatggccgaccgtcatgggtgcctaatg
gccaatcacggcgcgacggtcctaggcgaaaccgtcgacaaggctcgctggcggctggaa
gagctcgagacactggcacgcacctacctgttcagcagcatagggggcgcgccgcatatc
ctgtcggatgccgagattgctgaagtcatggtggctttctcaagttacgggccacgtcat
cccgaagagcggaacggggagggagagagatcatga

DBGET integrated database retrieval system