KEGG   Dinoroseobacter shibae: Dshi_0648Help
Entry
Dshi_0648         CDS       T00612                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dsh  Dinoroseobacter shibae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dsh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(650663..651262)
Genome map
AA seq 199 aa AA seqDB search
MSTAPKDIETLIDLMARLPGLGPRSARRAVLFLLGKNRRLLAPLGEAMTAVAQTARDCLN
CGNIGTSDICDICTSEKRATGEICVVEDVADLWAMERAGVFKGRYHVLGGTLSALDAVGP
EELRIPKLRDRAVSEGATEIILALGATVDGQTTAHYIAEALEGTGVAVTSLAQGVPIGGE
LDYLDDGTITAALRARKSF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgcgcccaaggatatcgaaacgctgatcgacctgatggcgcggctgcccgga
ctgggcccgcgctcggcccggcgcgcggtgctgttcctgctcggcaagaaccgccgcctt
ctggcgcccctgggcgaggccatgaccgccgtggcccagaccgcccgcgattgcctgaac
tgcggcaatatcggcaccagcgatatctgcgacatctgcacgtccgaaaaacgcgccacc
ggcgagatctgcgtggtcgaggatgtcgcggacctctgggcgatggagcgggcgggcgtg
ttcaagggccgctaccacgtgctcggcggcacgctctcggcgctcgatgcggtcggcccc
gaagagctgcgcatccccaagctgcgcgaccgcgcggtcagcgagggcgcgaccgagatc
atcctcgccctcggcgccacagtggacggccagaccaccgcccattacatcgccgaagcg
ctggaaggcaccggcgtcgcggtgacgagcctcgcccagggcgtgcccatcggcggcgag
ctcgactatctcgacgacgggacgatcaccgcggccctgcgggcgcgcaaatcgttttga

DBGET integrated database retrieval system