KEGG   Dinoroseobacter shibae: Dshi_0654Help
Entry
Dshi_0654         CDS       T00612                                 

Gene name
cycM
Definition
(GenBank) cytochrome c552
  KO
K08738  cytochrome c
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dshi_0654 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrome-c551
Motif
Other DBs
NCBI-ProteinID: ABV92400
RoseoBase: Dshi_0654
UniProt: A8LQB4
Position
656214..656738
Genome map
AA seq 174 aa AA seqDB search
MFDTMTMTKIVGGFCGALLVFLLGTWASSILYGTYGGPKAGENQAYVIDTGEEEESVAEA
EEVVELPFAEVYAAADAGAGERLWRQCQACHKLEAGANGVGPYLHGIVDRPKHAADGYAY
SDALLSQDGAWTPENISAFLENPREYAPGTKMAYRGMPDVEDRANLIAYLATYQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacaatgacgatgacgaagattgtgggtggcttttgtggagcacttctcgtg
ttcctgttgggcacgtgggcgtccagcatcctgtacggcacctatggcggtccgaaagcc
ggtgaaaaccaggcctacgtgatcgacacgggcgaagaagaagagtctgtggccgaagcc
gaagaggtcgtcgaactgccattcgccgaagtttacgccgccgccgatgcgggcgcgggc
gagcgcctgtggcgtcagtgccaggcctgccacaagctggaggcgggcgccaatggcgtg
ggcccctacctgcacggtatcgtcgaccggcccaagcacgcggccgatggctatgcctat
tccgacgcgctgctgtcccaggacggtgcatggacgcccgagaacatcagcgcgtttctc
gagaacccgcgcgaatatgcgccgggcaccaagatggcctatcgcggcatgcccgatgtc
gaggaccgcgcgaacctgatcgcctatctggcgacctaccagtaa

DBGET integrated database retrieval system