KEGG   Dinoroseobacter shibae: Dshi_0780Help
Entry
Dshi_0780         CDS       T00612                                 

Definition
alpha/beta hydrolase fold protein (EC:3.-.-.-)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dsh00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(785693..786637)
Genome map
AA seq 314 aa AA seqDB search
MTDPAPYRADLARAPQDARAVWVRADDGVRLRVALHATGDKGTVLIFPGRTEWVEKYGRV
AGDLASAGYSALVIDWRGQGLSDRLLDDPLKGHVADFPDYQMDVQAALDCARDAGLPEPY
FLIAHSMGGAIGLRAVMQDLPVRGAVFSGPLWGVKFPLWARPVAGLLGTLSSWFGLGEGY
APSTSPEPYILTAPFHDNLLTTDRAEYQDMADQMRAEPGFALAGPTMIWVHEANCECKWL
ATQPSPALPCLTLLGTNERIVDVGVIHERMARWPGGELVLVEGGEHEVLMESPDKRDPLI
ARMIAFFDAHRGTA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgacggaccctgccccctatcgcgcggacctcgcacgggccccgcaggacgcgcgcgcc
gtctgggtgcgcgccgatgacggcgtgcgcttgcgggtggcgctccatgccacgggcgac
aagggcacggtcctgatcttccccggtcgcaccgagtgggtcgagaaatacgggcgggtc
gccggggatctggcgtccgcgggctacagcgcgctggttatcgactggcgcggacagggt
ctgtcggaccgcctgctggatgatccgctcaagggccatgtggccgattttccggactac
cagatggatgtgcaggccgcgctggattgcgcccgggatgcagggttgccggagccctat
ttcctgatcgcgcattccatgggcggcgccatcggcctgcgtgcggtgatgcaggacctg
ccggtgcgcggcgcggtgttctccgggccgctctggggggtgaaattcccgctctgggcg
cggcccgtggcggggcttctgggcacgctgtcttcgtggttcgggctcggcgagggatac
gcgcccagcaccagcccggagccctatatcctgaccgccccctttcacgacaacctgctg
accaccgaccgggccgagtatcaggacatggccgaccagatgcgggccgagccgggcttt
gccctggccgggccgacgatgatctgggtgcacgaggccaattgcgaatgcaaatggctc
gcgacgcagccctcccccgccctgccctgcctgaccttgctgggcacgaacgagcggatc
gtggatgtgggcgtgatccacgagcgcatggcgcgctggcccggcggcgagctggtcttg
gtcgagggcggcgaacacgaggtgctgatggaatcacccgacaagcgcgacccgctgatc
gcgcggatgatcgcgttcttcgacgcgcatcgcggcaccgcgtag

DBGET integrated database retrieval system