KEGG   Dinoroseobacter shibae: Dshi_0828Help
Entry
Dshi_0828         CDS       T00612                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
dsh  Dinoroseobacter shibae
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dsh00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
835752..837059
Genome map
AA seq 435 aa AA seqDB search
MTARTVIAAVRDGAPVVAEDLRAFARGLASGTVSDAQAGAFAMAVLLRGLGDAGRVALTQ
AMRDSGDVLAWDLPGPVLDKHSTGGIGDTVSLLLAPALAACGAYVPMISGRGLGHTGGTL
DKLEALEGYRTDISEDALRAVVAETGCAIVGATGQIAPADRRLYAIRDVTATVESIDLIT
ASILSKKLAAGLGGLVLDVKCGSGAFLTDPAAARDLAQALVRTANGAGCPTWALLTDMDE
SLASAAGNALEVAEVLRILRGDATSPRLRAATVALGGALLALGGLADDPADGAARIDATL
RDGRAAEVFARMVAALGGPRDVVATGLAGLPEAPVVREVPAPAAGVLTACDAKALGWAVV
SLGGGRQVETDPVDPAVGLSDIAPLGTRVVRGEPIARVHAAREEAADRAVAEVQAAFTLG
TSFDAKPLVLGEVRP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcggacggtgatcgcggcggtgcgggacggcgcgccggtggtggcggaggac
ctgcgcgccttcgcccggggcctcgcctccggcacggtcagcgatgcccaggccggggcc
ttcgccatggcggtcctgttgcggggcttgggcgatgcggggcgcgtggcgctgacgcaa
gccatgcgcgacagtggcgatgtgctggcctgggacctgcccgggccggtgctcgacaag
cattccacgggcgggatcggggatacggtgtcgctcctgctggccccggcgctggcggcc
tgcggggcttacgtgccgatgatctcgggccgggggctgggtcatacgggcggcacgctc
gacaaactcgaggcgctggagggctaccgcaccgacatttccgaggatgcgctgagggcg
gtggtggccgagaccggctgcgccatcgtcggggccacgggccagatcgcgcccgcggac
cggcggctctatgccatccgcgacgtcaccgccacggtcgaaagcatcgacctgatcacc
gcctcgatcctgtccaagaagctcgcggcggggctgggcgggctggtgctggatgtcaaa
tgcggctcgggcgcgtttctgaccgaccccgcagcggcccgggatctggcgcaggcgctg
gtgcgcacggccaatggcgcgggctgtcccacctgggcgctgctgacggatatggatgag
agcctcgccagtgccgcgggcaatgcgctggaggtggcggaggtgctgcgtatcctgcgg
ggcgacgcgacgagcccgcgcctgcgcgcggcgaccgtggccctgggcggggcgctgctg
gccctgggcgggctggcggacgaccccgcggacggggctgcacggatcgacgccaccctg
cgcgatggccgcgcggcggaggttttcgcccgcatggtcgctgcccttggcgggccgcgc
gacgtggtggccacgggccttgccggtttgcccgaggcgccggtggtgcgcgaagtgccc
gcacccgcggcgggcgtgctgaccgcctgcgatgccaaggcgctgggctgggcggtggtg
tccctgggcggcggacggcaggtggaaaccgacccggtcgacccggcggtgggcctgtcg
gatatcgccccgctcggcacccgcgtcgtccggggcgagcccatcgcccgggtccatgcc
gcccgcgaagaggccgccgaccgcgccgtggccgaggttcaggcggccttcaccctcggc
acgagtttcgacgcgaagccgcttgtcctcggagaggtccgcccatga

DBGET integrated database retrieval system