KEGG   Dinoroseobacter shibae: Dshi_0835Help
Entry
Dshi_0835         CDS       T00612                                 

Gene name
fadJ
Definition
3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
dsh  Dinoroseobacter shibae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dshi_0835 (fadJ)
   01212 Fatty acid metabolism
    Dshi_0835 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dshi_0835 (fadJ)
   00650 Butanoate metabolism
    Dshi_0835 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Dshi_0835 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Dshi_0835 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dshi_0835 (fadJ)
   00310 Lysine degradation
    Dshi_0835 (fadJ)
   00380 Tryptophan metabolism
    Dshi_0835 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dshi_0835 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dshi_0835 (fadJ)
   00281 Geraniol degradation
    Dshi_0835 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Dshi_0835 (fadJ)
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dshi_0835 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dshi_0835 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Dshi_0835 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(844051..846264)
Genome map
AA seq 737 aa AA seqDB search
MNDMTDFTMKTDADGVAIITWDVQGKSMNVMNQQGFEDLDALVDKALADDTVKGIIITSG
KDSFAGGMDLNVIAKMRDDAGDDPARGLFEGVMAMHGILRKIERAGMDPKTNKGGKPVAA
ALPGTALGIGLEIPLACHRIFAADNPKAKIGLPEIMVGIFPGAGGTMRVSRKLGAMQAAP
ILLEGKLFEPKKAKMAGIVDEVVPAEELLDAAKAWVLSAKDTDIVKPWDLKGYKFPGGAP
YHPAGFMTFVGASAMIHSKTMGVYPAAKALLSAVYEGAMVPFDTALKIEARWFTNVLMNP
SSSAMIRSLFINKEALEKGAVRPDVPDQKVKKVGILGAGMMGAGIAYVSANAGIEVVLID
AAQESADRGKAHAAGILDKGIARKKVTPEKKDEVLARITATTDYAALEGCDLVVEAVFED
PGVKAEVTAKAEAVIPGDAIFATNTSTLPISELAKASARPEQFIGIHFFSPVDKMLLVEI
IKGRQTGDVAVAKALDFVRQIRKTPIVVNDARFFYANRCIIPYINEGIRMVAEGVTPALV
ENAAKLVGMPLGPLQLVDETSIDLGVKIAKATKAAMGDAYPDGAVDEVLFWMADEGRLGR
KSNAGFYTYDEAGKRGLLWEGLADRYPAAKEQPELTAVQHRLLMAQVLEAVRALEDGVLM
DIREGDVGAILGWGFAPWSGGPLSWLDMIGAARAVEICDALTDTHGARFTTPALLREMAE
KGETFYGRFGAETRKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatgaccgatttcaccatgaaaacggacgccgacggcgtcgccatcatcact
tgggacgtccagggcaaatccatgaacgtcatgaaccagcaagggttcgaggatctcgac
gcgctggtcgacaaggcgctggccgatgacaccgtcaaggggatcatcatcacctccggc
aaggacagctttgcgggcggcatggacctcaacgtcatcgccaagatgcgcgacgacgcc
ggcgacgacccggcccgtggcctcttcgagggcgtgatggccatgcacggcatcctgcgc
aagatcgagcgcgccgggatggaccccaagaccaacaagggcggcaaacccgtcgccgcc
gccctgcccggcaccgcgctcggcatcgggctggagatcccgctcgcctgtcaccggatt
ttcgccgccgacaaccccaaggccaagatcggcctgcccgaaatcatggtcggcatcttc
cccggcgcgggcggcaccatgcgggtgtcgcgcaagctgggcgcgatgcaggctgcgccc
atcctgctcgaaggcaagcttttcgagccgaaaaaggccaagatggccggcatcgtggac
gaagtggtgcccgcggaggagctgctcgacgccgccaaggcctgggtgctctccgccaag
gatactgatatcgtcaagccctgggacctcaagggctacaagttccccggcggcgcgccc
taccacccggcgggcttcatgaccttcgtcggcgccagcgccatgatccattccaagacc
atgggcgtctacccggcggccaaggcgctgctgagtgcggtctacgaaggggccatggtt
cccttcgacaccgcgctcaagatcgaggcgcgctggttcaccaacgtcctgatgaacccg
tcgtccagcgccatgatccgctcgctcttcatcaacaaggaggcgctggaaaaaggcgcc
gtccgtcccgacgtgcccgaccagaaggtgaagaaggtcggcatcctcggcgcggggatg
atgggcgcgggcatcgcctatgtctcggccaatgccgggattgaagtggtgctgatcgac
gccgcccaagagtccgcggatcgcgggaaggcccatgccgcgggcatcctcgacaagggc
atcgcgcgcaagaaggtcacgcccgagaagaaggacgaggtgctcgcccgcatcaccgcc
accacggactatgccgccctcgaagggtgcgacctggtggtcgaggcggtgttcgaagat
ccgggcgtcaaggccgaggtgaccgcaaaggccgaagccgtgatccccggcgatgcgatc
ttcgcgaccaacacctccaccctgccgatctcggagctggccaaggccagcgcccggcct
gagcagttcatcggcatccatttcttttcgcccgtggacaagatgctgctggtggagatc
atcaaggggagacagaccggcgatgtggccgtggccaaggcgctcgatttcgtgcgccag
atccgcaagacgcccatcgtggtcaacgacgcgcggttcttctacgccaaccgctgcatc
attccctacatcaacgaaggcatccgcatggtggccgagggcgtcaccccggcgctggtc
gaaaacgctgcgaaactggtgggcatgccgctggggccgctgcaactggtggacgaaacc
tccatcgacctgggcgtcaagatcgccaaggccacgaaagcggccatgggcgacgcctac
ccggacggcgccgtggacgaggtgctgttctggatggcggacgaaggccgcctgggccgc
aagtccaatgcgggcttctacacctatgacgaggcgggcaagcgtggtctgctctgggaa
gggctggccgaccgctacccggcggccaaggaacagcccgagctgaccgccgtgcagcac
cgcctgctcatggcccaggtgctggaggccgtgcgcgccctggaggacggcgtgctcatg
gacatccgcgagggcgacgtgggcgccatcctcggctggggcttcgcgccgtggtccggt
ggcccgctcagctggctcgacatgatcggcgccgcccgcgcggtggagatctgcgatgcg
ctgaccgacacccacggcgcccgcttcaccacgcccgcgctcctgcgcgaaatggccgag
aagggcgagaccttctatggccgcttcggggcggagacccgcaaagccgcctga

DBGET integrated database retrieval system