KEGG   Dinoroseobacter shibae: Dshi_0931Help
Entry
Dshi_0931         CDS       T00612                                 

Gene name
adhA
Definition
alcohol dehydrogenase GroES domain-containing protein (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dshi_0931 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_0931 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Dshi_0931 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dshi_0931 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dshi_0931 (adhA)
   00626 Naphthalene degradation
    Dshi_0931 (adhA)
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dshi_0931 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(955308..956327)
Genome map
AA seq 339 aa AA seqDB search
MSMMKAALVTDFSKPLEIREVRKPTVTDGNILVKIEACGVCHTDLHAARGDWPVKPEPPF
IPGHEGVGVVVEVGHNVTSVKEGDRVGVPWLHHACGHCTACVTGWETLCRTEPEYTGYTV
NGGFAEYVEADPTYVGHLPDKLDFAPAAPILCAGVTVYKGLKECDLHPGQTVVISGIGGL
GHLAVQYARAMGLHVIAVDVAEDKLALARDLGAGVAINAATQDPVAEVARLGGAEGVLVT
AVSNTAFSQGVGMLAPGGTMSLVGLPPGDFPLNIFDVVLNRKTIRGSIVGTRADLAESLS
FAAEGKVASHYATDSLDNINGIFDQMEQGRIEGRIVMTM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgatgaaggccgctctcgtcaccgatttctcgaagccgctggagatccgtgaa
gtccggaaaccgaccgtcacggacggcaatatcttggtgaaaatagaggcttgcggggtc
tgccacaccgatctgcacgcggcgcgcggcgactggccggtcaagcccgagccacccttc
attccgggccacgaaggcgtgggcgtggtggtcgaggtcgggcacaatgtcacgtcggtc
aaggaaggcgaccgggtgggcgtgccttggctgcatcacgcctgcgggcattgcaccgcc
tgtgtcacgggctgggagacgctctgccggacggagccggaatacaccggctacacggtc
aatggcgggttcgcggagtatgtggaagcggatccgacctatgtcggacatctgcccgac
aagctcgatttcgcacctgctgcccccatcctgtgcgccggtgtgacggtctacaagggg
ctgaaggaatgcgacctgcatccaggccagaccgtcgtgatttccggcatcggcggactt
gggcaccttgcagtgcagtacgcgcgcgcgatgggtctgcatgtgatcgccgtcgacgtg
gccgaggacaagctcgccttggcccgcgacctcggcgcgggcgttgccatcaacgccgcg
acgcaggacccggtggccgaggtcgcgcggcttggcggggccgagggcgtccttgttacg
gccgtctcgaacaccgcgttctcacagggcgtggggatgctcgcacccggcggaacgatg
agcctcgtcggtcttccgccaggcgactttcctttgaacatcttcgacgtggtcctcaac
cgcaagacgatccgtggctccatcgtcggcacgcgcgccgacctcgccgagagcctctcc
ttcgcggccgagggaaaggtcgcctcgcattacgcaaccgacagcctcgacaatatcaac
ggcatcttcgaccagatggaacagggccggatcgagggccggatcgtgatgacgatgtga

DBGET integrated database retrieval system