KEGG   Dinoroseobacter shibae: Dshi_0952Help
Entry
Dshi_0952         CDS       T00612                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dshi_0952 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dshi_0952 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dshi_0952 (trpA)
Enzymes [BR:dsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dshi_0952 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(976376..977194)
Genome map
AA seq 272 aa AA seqDB search
MGYRDAGLTMTRIDETFARLRAEGKKAFVAYVMGGDPDYDTSLEIVRGLPAAGVDIIELG
MPFTDPMADGPTIQLAGQRALEAGQTLDKTLDLARALRETDDATPIVMMGYYNPIYSRGV
DRFLADAKDAGIDGLIVVDLPPEEDSELCIPAQAAGLNFIRLATPTTDDARLPKVLQNTS
GFVYYVSITGITGAAQAQASDVAPEVARIKSATDLPVIVGFGVKTPELAESIAGVADGTV
VGSAIVKMVEDGKPVPEILGFVADLAAGAHRA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggctacagggacgcagggctgaccatgacacggatcgacgagacattcgcgcggctg
cgggcagaaggcaagaaagccttcgtggcctatgtgatgggcggcgatccggattacgac
acctcgctggagatcgtgcgcggcctgcccgcggcaggcgtcgacatcatcgagcttggc
atgcccttcaccgaccccatggccgacggccccacgatccagcttgcgggccagcgcgcg
ctggaggcgggccagaccctcgacaagaccctcgatctcgcccgcgccctgcgcgagacc
gacgatgcgacaccgatcgtgatgatgggctactacaacccgatctattcccgcggggtg
gaccgttttctcgcggatgccaaagacgccgggatcgacgggctgatcgtcgtggacctg
ccccccgaggaagacagcgagctttgcatccccgcccaggccgcgggtctgaacttcatc
cggctggccacacccacaaccgacgacgcgcgcctgcccaaggtgctgcagaacacgtcc
ggcttcgtctactacgtgtcgatcaccgggatcaccggcgcggcgcaagcgcaggccagc
gatgtggccccggaagtggcccggatcaaatccgccaccgacctgccggtgatcgtgggc
ttcggcgtcaagacccccgagctggccgagagcatcgcgggcgtggctgacggcaccgtg
gtgggctccgccatcgtcaagatggtcgaggacggcaagcccgtgccggagatcctgggc
ttcgtggccgatctcgccgcgggcgcgcaccgggcctga

DBGET integrated database retrieval system