KEGG   Dinoroseobacter shibae: Dshi_0952Help
Entry
Dshi_0952         CDS       T00612                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00260  Glycine, serine and threonine metabolism
dsh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01130  Biosynthesis of antibiotics
dsh01230  Biosynthesis of amino acids
Module
dsh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dshi_0952 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dshi_0952 (trpA)
Enzymes [BR:dsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dshi_0952 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ABV92697
RoseoBase: Dshi_0952
UniProt: A8LRZ0
Position
complement(976376..977194)
Genome map
AA seq 272 aa AA seqDB search
MGYRDAGLTMTRIDETFARLRAEGKKAFVAYVMGGDPDYDTSLEIVRGLPAAGVDIIELG
MPFTDPMADGPTIQLAGQRALEAGQTLDKTLDLARALRETDDATPIVMMGYYNPIYSRGV
DRFLADAKDAGIDGLIVVDLPPEEDSELCIPAQAAGLNFIRLATPTTDDARLPKVLQNTS
GFVYYVSITGITGAAQAQASDVAPEVARIKSATDLPVIVGFGVKTPELAESIAGVADGTV
VGSAIVKMVEDGKPVPEILGFVADLAAGAHRA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggctacagggacgcagggctgaccatgacacggatcgacgagacattcgcgcggctg
cgggcagaaggcaagaaagccttcgtggcctatgtgatgggcggcgatccggattacgac
acctcgctggagatcgtgcgcggcctgcccgcggcaggcgtcgacatcatcgagcttggc
atgcccttcaccgaccccatggccgacggccccacgatccagcttgcgggccagcgcgcg
ctggaggcgggccagaccctcgacaagaccctcgatctcgcccgcgccctgcgcgagacc
gacgatgcgacaccgatcgtgatgatgggctactacaacccgatctattcccgcggggtg
gaccgttttctcgcggatgccaaagacgccgggatcgacgggctgatcgtcgtggacctg
ccccccgaggaagacagcgagctttgcatccccgcccaggccgcgggtctgaacttcatc
cggctggccacacccacaaccgacgacgcgcgcctgcccaaggtgctgcagaacacgtcc
ggcttcgtctactacgtgtcgatcaccgggatcaccggcgcggcgcaagcgcaggccagc
gatgtggccccggaagtggcccggatcaaatccgccaccgacctgccggtgatcgtgggc
ttcggcgtcaagacccccgagctggccgagagcatcgcgggcgtggctgacggcaccgtg
gtgggctccgccatcgtcaagatggtcgaggacggcaagcccgtgccggagatcctgggc
ttcgtggccgatctcgccgcgggcgcgcaccgggcctga

DBGET integrated database retrieval system