KEGG   Dinoroseobacter shibae: Dshi_0977Help
Entry
Dshi_0977         CDS       T00612                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dsh  Dinoroseobacter shibae
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dshi_0977 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dshi_0977 (murA)
Enzymes [BR:dsh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Dshi_0977 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
998735..1000003
Genome map
AA seq 422 aa AA seqDB search
MDQIVIRGGVPLHGAIPIAGAKNACLTLMPATLLSDEPLTLTNAPRLSDIATMTALLRSL
GAEVSTLQDGKVLALSSHRIDNHTAEYDIVRKMRASILVLGPMLARDGHAVVSLPGGCAI
GARPVDLHLKGLEALGADLTLTDGYVHAKAPGGLKGAVFEFPFVSVGATENILMAATLAK
GTTVLKNAAREPEIVDLARCLRKMGAQIEGEGTSRITVQGVDRLHGATHPVVTDRIELGT
YMLAPAITGGEVELIGGRLDLVAAFAERLAAAGVDVSETAHGLTVKRANGRVGAVDVVTE
PFPGFPTDLQAQMMALLCTADGVSVLEERIFENRFMHAPELIRMGARIDVHGGTATVTGV
PQLKGAPVMATDLRASVSLILAALAAEGETVVSRVYHLDRGYERVEEKLSACGAQIERVK
ET
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaccagatcgtgatccgggggggcgtgcccctccatggggccattcccattgctggg
gccaagaatgcctgtctgacgttgatgccggccaccttgctgagcgatgagcctctgacc
ctgaccaatgcgccgcgtctgagcgacatcgccacgatgaccgcattgctgcgctcgctc
ggggccgaggtcagcacgctgcaggacggtaaggtcctggcgctatccagccacaggatc
gacaaccataccgccgagtatgatatcgttcgcaagatgcgggcctcgatcctggtgctg
gggccgatgctggcgcgggatggtcatgcggttgtttcgcttccggggggctgcgccatc
ggcgcgcgtcccgttgacctgcacctcaagggattggaagcgctgggcgcggatctgacg
ctgacggacggctatgttcacgccaaggcgcccgggggcctgaagggcgctgtgttcgag
tttccgttcgtgtccgtcggcgccacggaaaacatcctgatggccgccacgctcgccaag
ggcaccactgtgttgaaaaacgctgcgcgcgagcctgagatagtcgatctggcccggtgt
ctgcgcaagatgggggcgcagatcgagggcgagggcacatcccggatcacggttcaggga
gtggaccggctgcacggcgcgacccatccagtggtgaccgaccggatcgagttggggacc
tacatgctggccccggccatcactggcggagaggtcgagttgatcggtggacggctcgac
ctggtcgcagcctttgcagagcgcctcgcggcggctggcgtcgatgtgtccgaaaccgcc
catggcctgactgtcaagcgcgccaatggccgggtcggggcagtggacgtggtcacagaa
cccttccccggcttccctacggatttgcaggcgcagatgatggcgctcctgtgcaccgcg
gacggggtttccgtgctcgaagagcggattttcgagaaccgcttcatgcatgcgcccgaa
ctgatccgcatgggtgcgcggatcgacgtccatggcgggaccgccacggtcaccggggtg
ccacaactcaagggcgcgccggtgatggccacggacctgcgcgcgagcgtgtcgcttatc
ctcgcggccctcgccgccgagggcgaaaccgtcgtcagtcgtgtctatcaccttgaccgc
gggtacgagcgggtcgaagagaagctcagcgcttgtggcgcgcagatcgagcgggtgaag
gaaacatga

DBGET integrated database retrieval system