KEGG   Dinoroseobacter shibae: Dshi_1078Help
Entry
Dshi_1078         CDS       T00612                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dshi_1078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_1078
  Lipid metabolism
   00071 Fatty acid degradation
    Dshi_1078
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dshi_1078
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dshi_1078
   00626 Naphthalene degradation
    Dshi_1078
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dshi_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1106016..1107053
Genome map
AA seq 345 aa AA seqDB search
MRAAVLRAYNEDLVLEDVPEPVCPEDGVVLKVLACGVCRSDWHGWVGEHPRVKPGQIGGH
EYCGEVIEAGPRAAFKPGDRVVAPFILACGSCPSCQAGAQNTCPNQRLPGFVEPGAFAEY
VAVPFDHNLSRLPDSLSPTVAAGLGCRVTTAWHALTGRAAVQGAEWVAVHGTGGIGLSSV
ILANALGARVIAVDVVDEKLTHAAQHGAEVTLNAREGDVAARIKQITGGGAHVAIEALGI
PETVNASLECLRPLGRHVQVGLPTGHTARMEINMSAIYQGNLAVYGTRGMPSWRYPSLLS
LIETGRVDMSPLIAREIGLSGTSAELRAFNGPTPPGVAVITDFQS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcggcggttctgcgggcctataacgaggatctggtcctcgaggatgtgcccgag
ccggtctgccccgaagacggtgtcgttctcaaggtgctggcctgcggcgtgtgccggtcc
gactggcacggctgggtcggggagcatccgcgggtcaagcccggccagatcggcgggcac
gagtattgcggcgaggtgatcgaggccgggccgcgggcggccttcaagccgggcgaccgg
gtggtggcgcctttcatcctggcctgcgggtcctgcccgtcctgccaggcgggggcccag
aatacctgccccaaccagcgcctgccgggctttgtcgagccgggtgcctttgccgaatac
gtggcggtgcccttcgatcacaacctgtcgcggctgcccgacagcctgtcgcccacggtg
gcggcggggctgggatgccgggtgacgaccgcgtggcatgccctgaccgggcgggcggcg
gtgcagggcgcggaatgggtcgcagtgcatggcacgggcgggatcggcctgtcctcggtg
atcctggccaatgcgctgggcgcgcgggtgatcgcggtggatgtggtcgacgagaagctg
acccatgccgcacagcatggcgccgaagtgacgctgaacgcccgcgagggcgacgtggcc
gcgcgcatcaagcagatcactggcggcggtgcccatgtggcgatcgaggcgctgggcatt
cccgagacggtgaatgcttcgctcgaatgtctgcggcccctgggacggcatgtgcaggtg
ggcctgcccacgggccacaccgcgcggatggagatcaacatgtccgcgatctatcagggc
aacctggcggtttacggcacgcgggggatgccgtcgtggcgctacccgtcgctgctgagc
ctgatcgagaccgggcgggtggacatgtcgccgctcatcgcccgcgagatcgggctgtcg
ggcacctcggccgaactgcgcgccttcaacggtccgaccccgcccggggtggccgtgatc
accgatttccagagctga

DBGET integrated database retrieval system