KEGG   Dinoroseobacter shibae: Dshi_1104Help
Entry
Dshi_1104         CDS       T00612                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dsh  Dinoroseobacter shibae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dshi_1104 (ruvA)
Enzymes [BR:dsh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dshi_1104 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1130489..1131163
Genome map
AA seq 224 aa AA seqDB search
MIGRLSGVLVYRGRDHIVLDVRGVGYVVQCSERTLAGMPAPGGPVALFTELLVREDLLQL
YGFPTLLEKEWHRLLTSVQGVGAKASMSILSTLGVDGVGRAIALGDWGALRKAQGVGPKI
AQRVVNELKDKGPEVMAMGGTLEAALDGVIEDGMAASEGIEPPSAARPAVPSAASDQAGA
LSALVNLGYGQGEAASAVATAAGEGAVGETDIIRAALRLLAPKG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcggctgtcgggggttctggtctatcgcgggcgggatcacatcgtgttggat
gtgcgcggcgtgggctatgttgtgcaatgctccgaacgcacgctggcggggatgcccgcg
cccggcgggcccgtggcgctctttaccgaacttctggtgcgcgaggatctgttgcagctt
tacgggtttcccacgctgcttgagaaagagtggcaccggcttttgacatctgtgcagggg
gtgggggccaaggcctccatgtcgatcctgtcgaccctgggggtggacggggtcgggcgg
gcgattgcactgggtgattggggcgcgttgcgcaaggcccaaggtgtgggtccgaagatc
gcgcagcgggtggtcaacgagttgaaggacaaggggccggaggtgatggccatgggcggg
acgctggaggccgcgttggacggtgtcatcgaggacggcatggccgcctcggagggcatc
gagcccccctcggcggcgcgcccggcggtgccgtccgccgccagcgaccaggccggggca
ctctcggcgctggtcaatctgggctatgggcagggcgaggcggccagtgccgtagccact
gcggcgggcgagggggccgtgggcgagaccgatatcatccgcgcggccctgcgcctgttg
gcgccgaaaggataa

DBGET integrated database retrieval system