KEGG   Dinoroseobacter shibae: Dshi_1146Help
Entry
Dshi_1146         CDS       T00612                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dshi_1146 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dshi_1146 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dshi_1146 (thrC)
Enzymes [BR:dsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dshi_1146 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1172413..1173804
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGQAPAMAFHEAMLAGLASDGGLYVPETVPTLTEAEIRAMAGLPYEEIAFRVMM
PFLGNSFTEEEFRTDIATAYGGFGHDARAPLKQLGPNHFLLELFHGPTLAFKDFAMQLIG
QLFQRELTRRGSRVTIVGATSGDTGSAAIEAFRGIASVDVFILYPHGRVSEVQRRQMTTP
TEDNVHALALHGHFDDCQARLKDMFNDHGFRDGVRLAGVNSINWARVLAQVVYYFSAATS
LGAPDRKISFTVPTGNFGDIFAGYIARRMGLPIDTLVIATNQNDILHRCLTTGAYETDAV
IPSISPSMDIQVSSNFERLLFDVYDRDGAAVAQLMDELKTKGGFTLSQGALTRLREGFAS
GRASEDETSATITRARDTMNELLCPHSAVGVHVAEQHIEPGVPMVTLATAHPAKFPAAVE
AATGVHPPLPPRMETLYERPERLTEVPNDLGALQTLIRERIDP
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatctctacccgcgggcaggccccggccatggccttccacgaagcgatgctg
gcggggctggcgagcgatggcgggctctacgtccccgaaaccgtgcccaccctcaccgag
gccgagatccgcgccatggccggtctgccctacgaagagatcgcgttccgggtgatgatg
cccttcctgggcaacagcttcaccgaagaagaattccgcaccgacatcgccaccgcctac
ggcgggttcggccacgacgcccgcgcgcccctgaaacagctcgggcccaaccatttcctg
ctggagctcttccacggcccgacgctggcgttcaaggacttcgccatgcagctcatcggg
cagctcttccagcgggagcttacccggcgcggcagccgcgtgaccatcgtgggcgccacc
tccggcgataccggctccgcggcgatcgaggcgttccgcggcatcgcgtccgtggatgtg
ttcatcctctatccccacggccgggtctccgaggtgcagcgccgccagatgaccacgccc
accgaggacaacgtccatgccctcgccctgcacggccatttcgatgactgccaggcgcgg
ctgaaggacatgttcaacgaccacggcttccgcgacggggtgcggctggcgggcgtgaat
tcgatcaactgggcgcgggtgctggcccaggtcgtctactacttctccgccgcgaccagc
ctgggcgccccggaccgcaagatcagcttcaccgtgcccactggcaatttcggcgacatc
ttcgcaggctacatcgcgcggcgcatgggcctgcccatcgacacccttgtgatcgccacc
aaccagaacgacattctgcaccgctgcctgaccaccggggcctacgagaccgacgcggtc
atcccctcgatcagcccgtccatggatatccaggtcagctcgaatttcgagcggctcctg
ttcgacgtctacgaccgggacggggcggcggtggcgcagctgatggacgagttgaagaca
aagggcggcttcaccctgtcgcaaggcgcgttgacccgcctgcgcgaaggcttcgcctcg
ggccgcgcgtccgaggacgagacctccgccaccatcacccgcgcacgcgacaccatgaac
gagcttttgtgcccgcattcggcggtgggcgtgcatgtggccgagcagcatatcgagccc
ggcgtgcccatggtcacgctggccaccgcgcatccggcgaagttccccgccgcggtggag
gccgcgaccggggtgcatccgccccttccgccgcggatggaaacgctctatgagcggccc
gaacgcctgaccgaagtgcccaacgacctcggcgcgctgcaaacccttatccgcgaacgg
atcgacccatga

DBGET integrated database retrieval system