KEGG   Dinoroseobacter shibae: Dshi_1227Help
Entry
Dshi_1227         CDS       T00612                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00620  Pyruvate metabolism
dsh00630  Glyoxylate and dicarboxylate metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dshi_1227 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    Dshi_1227 (glcB)
Enzymes [BR:dsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dshi_1227 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase B2
Motif
Other DBs
NCBI-ProteinID: ABV92969
RoseoBase: Dshi_1227
UniProt: A8LIB5
Position
1269474..1271648
Genome map
AA seq 724 aa AA seqDB search
MKRVERAGLQVAPELVEFLETQALPGTGVTAAAFWEGLSALVHEEGPTNRALLAKRTELQ
RKIDAWHVARKGQPHDAAAYAAFLREIGYLVPEPEDFEIDTANVDPEIATIPGPQLVVPI
TNARYALNAANARWGSLYDALYGTDALGDLPSGKGFDPERGARVMAWARDHLDHAAPIAG
VSWADVTRIDVADGALELVAGDLRPLVDPAQFAGYTTGPAGDVTSVLLRKNGLHLRVMID
PTSRIGAADPAGISDVIIEAAISAIMDCEDSVAAVDAEDKVLAYGNWLGLMKGDLSQEVT
KGGKSFTRALARDVVATAPNGDRLVLKGRALMLVRNVGHLMTNPAILDRDGAEIGEGLMD
AMVTTLIAMHDLGRAGGNSVHGSVYVVKPKMHGPEEVAFTDRIFTRVEAALGLPANTVKI
GIMDEERRTSANLKACIHAARSRVAFINTGFLDRTGDEIHTSMEAGPVLPKGEMKGTAWI
AAYEDRNVDIGLACGLKGRAQIGKGMWAMPDLMADMLEAKIGHPMSGANCAWVPSPTAAT
LHATHYHKVDVFARQDEIAAGGARGTLEDLLTIPLLEGRSLSAAEIAAEVENNAQGILGY
VVRWIDQGVGCSKVPDIHDVGLMEDRATCRISSQALANWLHHGIVSEEQVMGALRKMAAV
VDQQNAGDPAYRPMAPGFDGIAFAAACDLVFAGREQPSGYTEPVLHARRLELKAALVAPE
ALRA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggtagagcgcgcaggtctgcaggtggcccccgagcttgtggagttcctcgaa
acgcaggcgctgccgggcacgggtgtgaccgcggcggcgttctgggaggggttgtcggcg
ctggtccatgaggaaggcccgaccaaccgggcgctgctggccaagcgcacggagttgcag
cgcaagatcgatgcctggcatgtcgcgcgcaagggccagccccatgacgcggcggcctat
gcggcgttcttgcgcgaaatcggctaccttgtgccggagcctgaggatttcgagatcgac
accgccaacgtggatccggagatcgcgaccattcccggcccgcagcttgtcgtgccgatc
accaatgcgcgctatgccctgaacgcggcgaatgcgcgctgggggtcgctctatgacgcg
ctttacggcacggatgccctgggcgatctgccgtcgggcaaggggttcgatcccgagcgc
ggggcgcgggtgatggcctgggcgcgggatcacctggaccatgcggccccgattgcgggc
gtgtcctgggcggatgtcacgcggatcgacgtggccgatggggcgctggagctggtggcg
ggcgatctgcgcccgctggtcgatccggcgcaattcgcaggctacaccacggggcctgcg
ggcgatgtgacctcggtgctgctgcgcaagaacgggctgcatctgcgggtgatgatcgac
cccacgagccgtatcggcgcggcggatccggcggggatttccgacgtcatcatcgaggcg
gcgatctcggccatcatggattgcgaggacagtgtcgcggcggtggatgcagaggacaag
gtgctggcctatggcaactggctgggcctgatgaagggcgacttgtcgcaagaggtgacc
aagggcggcaagagcttcacccgggcgttggcccgggacgtggtggcgaccgcgcccaat
ggcgaccggttggtgctgaagggtcgggcgctgatgctggtgcgcaatgtcgggcacctg
atgaccaacccggcgatcctggatcgcgacggggcggagatcggcgaggggctgatggat
gccatggtcaccacgctgatcgccatgcacgatctgggccgtgcggggggcaactcggtc
cacgggtcggtctatgtggtcaagccgaagatgcacgggcccgaagaggtcgccttcacc
gaccggatcttcacccgggtggaggcggcgctggggctgccggcgaacacggtcaagatc
gggatcatggacgaggagcggcgcacgagcgcgaacctcaaggcctgcatccatgcggcc
cggtcgcgggtggcgttcatcaacacgggcttcctcgaccgcacgggcgacgagatccac
acttcgatggaggcggggccggtcctgcccaagggcgagatgaagggcacggcctggatc
gcggcctacgaggatcgcaacgtggatatcggtctggcctgcgggctcaagggtcgggcg
cagatcggcaagggcatgtgggcgatgccggatttgatggcggatatgctggaggccaag
atcgggcacccgatgtcgggggcgaactgtgcctgggtgccgtcgccgaccgcggccacg
ctgcacgcgacccattaccacaaggtggatgtgttcgcgcggcaggacgagattgccgcg
ggcggggcgcgcgggacgctggaggacttgctgaccattcccttgctcgaaggccgcagc
ctgagcgcggcggagattgcggcggaggtcgagaacaacgcgcagggcattctcggctat
gttgtgcggtggatcgaccagggggtgggctgctccaaggtgccggatatccatgatgtg
ggactgatggaggaccgggcgacctgccggatcagttcgcaggcgctggccaactggctg
catcacgggatcgtctcggaagagcaggtgatgggggcgctgcgcaagatggccgcggtg
gtcgatcagcagaacgcgggcgatccggcttaccggcccatggcgcccggcttcgacggg
atcgcgtttgcggcggcctgcgacctggtgttcgccgggcgggagcagccttcgggctat
accgagccggtgctgcatgcgcggcggctggagctgaaggccgcgctggtcgcgcccgag
gcgctcagggcctga

DBGET integrated database retrieval system