KEGG   Dinoroseobacter shibae: Dshi_1239Help
Entry
Dshi_1239         CDS       T00612                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
dsh  Dinoroseobacter shibae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dshi_1239 (lacZ)
Enzymes [BR:dsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dshi_1239 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1285260..1287167)
Genome map
AA seq 635 aa AA seqDB search
MTRKLGVCYYPEHWPEDQWPRDAARMKDAGLTLVRIGEFAWSRLEPSPGDLRFDWLDRAI
SVLAEAGLEVVLGTPTATPPRWMLDRHPDMLAVDARGQPRKFGSRRHYCFSHPGYRAEAA
RIARLLGERYGRDPRIVAWQIDNEYGCHDTTLSYSDAARHGFRDWLAQRYQSTDALNRAW
GNVFWSMAYDRFDQIDLPNLTVTEPNPAHALAFRRYASDMVVAFNRAQVAALRPLTDAPL
IHNYMGRVTEFDHHAVGADLDIASWDSYPMGFLLDRVEAPADHKAAYLRQGDPDFQAFHH
DLYRGVGRDGRWWIMEQQPGPVNWAPWNPAPLPGMVRLWSHEAFAHGAEAVCFFRWRQAP
FAQEQMHAGLLRPDDSPAPGLEEAAALAADLPRLPDVSPSRAPVALVFDYPSQWAWEVQP
QGADFDYFALCFAMYRGLRKLGLSVDILPADPARLAGHDLILVPGLLHLSADMTAYLATT
QAQVLVGPRAGSKTPEMSIALPLGPNLQGLDATVTHVETLPPGAERALQRGGAAERWIEA
VETRAEILEETTEGAPVLIRTGRQHYLAAWPDPEAMGRILRDLCSRAGIQTTDMPEGVRQ
RVHGHHKLVVNYSSEMRVFENDALPPAGLVWKLIP
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcaagctgggcgtctgctactaccccgagcattggcccgaagaccaatggccg
cgggacgccgcacgcatgaaggacgcgggcctcaccctcgtccggatcggggaattcgcc
tggtcccggctcgaaccctcccccggcgatctgcggttcgactggctcgaccgtgccatt
tccgttctggccgaggccgggctggaggtcgttctgggcacccccaccgccacaccgccg
cgctggatgctcgaccgccaccccgacatgctggccgtggacgcccgcggccagccgcgc
aagttcggctcccggcggcactactgcttcagccatcccggctaccgggccgaggccgcg
cgcatcgcccgcctgctgggggagcggtacggccgcgacccccgcatcgtggcctggcag
atcgacaacgaatacggctgccacgacacaacgctcagctattccgacgccgcccggcat
gggtttcgcgactggctcgcccaacgttatcagtccaccgacgcgctcaaccgcgcctgg
ggaaacgtgttctggtctatggcgtacgaccgcttcgaccagatcgacctgccgaacctg
accgtgaccgagccgaacccggcccatgcgctggccttccggcgctacgcatcggacatg
gtggtggccttcaaccgcgcgcaggtcgcggccctgcgccccctgacggacgcaccgctg
atccacaactacatgggccgggtgaccgagtttgatcaccacgcggtgggcgcggacctc
gatatcgccagttgggacagctacccgatgggctttttgctcgaccgggtcgaagcaccc
gccgatcacaaggcggcctatctccgccagggcgacccggatttccaggccttccaccac
gacctctatcgcggggtcggacgggacggccgctggtggatcatggaacagcaacccggc
ccggtgaactgggcgccctggaaccccgcccccctgcccggcatggtgcggctgtggtcc
cacgaagccttcgcccacggcgccgaggcggtctgctttttccgctggcgccaggccccc
ttcgcgcaggagcagatgcatgcgggccttctgcgccccgacgacagcccggccccaggg
ctggaggaggccgcggccctggccgcagacctcccccggcttcccgacgtgtcaccgagc
cgcgcccccgtggcgctcgtgttcgactacccctcccaatgggcgtgggaggtgcagccc
cagggcgcggatttcgactatttcgccctgtgctttgcgatgtatcgcgggctgcgcaag
ctcggcctctcggtcgacatcctgcccgcggacccggcacggctggcgggccatgacctg
atccttgttcccgggcttttgcacctgtcagccgacatgaccgcatatctcgcaacgacc
caggcgcaggtgctggtcggcccgcgcgcgggttccaagacgccggagatgtccatcgcc
ctgccgctcggccccaatctgcaagggctcgacgccaccgtgacccatgtcgaaaccctg
ccccccggcgccgaacgcgcgctgcaacgcggcggggccgccgaacgctggatcgaggcc
gtcgagacccgcgccgagatcctggaggaaaccaccgaaggcgcccccgtcctgatccgc
accggacggcaacactacctcgcggcctggccggacccggaggccatgggccgcatcctg
cgcgatctctgctcgcgcgcaggcatccagaccaccgacatgcccgaaggcgtccgccaa
cgcgtccacggccaccacaagctggtggtcaattattcctccgaaatgcgggttttcgaa
aacgatgccttgccccctgcgggtctggtgtggaaattgatcccatga

DBGET integrated database retrieval system