KEGG   Dinoroseobacter shibae: Dshi_1544Help
Entry
Dshi_1544         CDS       T00612                                 

Definition
short-chain dehydrogenase/reductase family protein (EC:1.1.1.-)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dsh  Dinoroseobacter shibae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Dshi_1544
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dshi_1544
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Dshi_1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1605788..1606561)
Genome map
AA seq 257 aa AA seqDB search
MSLKGKTAVITGSNSGIGLGIAWELARAGADVVLNSFTDREEDHALADEIARETGVYARY
IKADMSKGDDCRALIESAGTCDILVNNAGIQHVAPIDEFPVDKWDAIIAINMNSAFHTTA
AALPMMRKAGWGRVVNIASAHGLTASPYKAAYVAAKHGVVGMTKTVALETAQEPITCNAI
CPGYVLTPLVEAQIPNTMEKYDMGREEVIKQVMLERQPSKEFATVEQLGGTCVFLCSDAA
AQITGTTISVDGGWTAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgaagggaaaaaccgccgttatcaccgggtcgaattcggggatcgggttgggg
attgcgtgggagttggcccgcgcgggtgcggatgtagtgctcaacagcttcaccgaccgg
gaggaggatcacgccctagccgacgagatcgcccgcgagaccggggtttatgcgcgctac
atcaaggcggacatgtccaagggcgacgactgccgggcgctgatcgagagcgcgggtacc
tgcgatatcctggtgaacaatgcgggtatccagcatgtggccccgatcgacgagtttccg
gtcgacaagtgggacgcgatcatcgcgatcaacatgaattcggcgttccacaccaccgcc
gccgccctgccgatgatgcgcaaggcgggctgggggcgggtcgtcaatatcgcctcggcg
cacggactgaccgcgtcgccctacaaggcggcctatgtggcggccaagcacggagtggtg
ggcatgaccaagaccgtggcgctggagaccgcgcaggagccgatcacctgcaacgcgatc
tgcccgggctatgtgctgaccccgctggtggaggcgcagatccctaacacgatggagaaa
tacgatatgggccgcgaggaggtcatcaagcaggtgatgctggagcgccagccgtcgaag
gaattcgcgaccgtcgagcagttgggcggcacctgcgtgttcctgtgctcggatgcggcg
gcacagatcaccgggacgacgatttcggtggatggcggctggaccgcgctctga

DBGET integrated database retrieval system