KEGG   Dinoroseobacter shibae: Dshi_1621Help
Entry
Dshi_1621         CDS       T00612                                 

Definition
putative 6-phosphofructokinase isozyme 2 (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dshi_1621
   01230 Biosynthesis of amino acids
    Dshi_1621
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_1621
   00030 Pentose phosphate pathway
    Dshi_1621
   00051 Fructose and mannose metabolism
    Dshi_1621
   00052 Galactose metabolism
    Dshi_1621
  Energy metabolism
   00680 Methane metabolism
    Dshi_1621
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dshi_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1685849..1686799)
Genome map
AA seq 316 aa AA seqDB search
MTRIVTLTLNPALDSSTDAEHVAPDLKLRCSAPRADAGGGGVNVSRAIAFLGGQSLAALA
LGGGPGERVRQLLRVEGIPVHDLGVAVETRQNLSVIARDTGAQYRFIMPGQTWTDVDVDR
SCEALCKLARAGDLIVPSGSLPPGVGPGDLVALTNRLAVLGVRIVLDTSGAALQAFATGR
AKTLHVLRMDLEEAQSLAGRDLDTVADVAQFGRELVDAGAAKSVIVAKGAEGSILVTSRG
QGWHVRPPKVNVVSKTGAGDSFVAGFTLALAQGSSDLEATVRGVGAAASAVTTPDTDLCD
GASAERYAALSTVTEL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgtattgtgacgctgacactcaatccagccttggattcgtcgaccgatgccgaa
cacgttgcgccggacctgaaacttcgctgctctgcgccccgcgccgatgcggggggcgga
ggcgtcaatgtctccagagccattgcgtttctcggcggacaatctcttgcggcgctcgcg
cttggcggcgggccaggggagcgggttcgacagcttcttcgagtggagggtattccggtg
catgatctcggcgtggctgtggaaacgcgccagaacctgtcggtcatcgcgcgggatacc
ggcgcgcagtatcgcttcatcatgcccggacagacctggacggacgtggatgttgatcga
tcatgtgaggcgctctgcaaactggcgagggccggggatctgatcgtgccatcgggcagc
ttaccaccaggtgtcggcccgggtgatctcgtagcgctgaccaatcgccttgctgtgctg
ggagttcggatcgttcttgatacgtccggggccgctttgcaggccttcgcaacaggaagg
gccaaaacccttcatgtgctgcggatggatctcgaggaagcacagtcgcttgcaggccgg
gacctcgacacagttgcggatgtggcgcagttcgggcgggagctggtggacgcgggggct
gcaaaaagcgtgattgtagccaagggagcggaaggcagtattcttgtcacatcacgcggg
cagggctggcatgtgcgccccccaaaggtgaacgtggtcagcaagaccggtgctggagac
agttttgtggcggggttcacgctggctctcgcacaaggttcgtccgatctggaagcgact
gtgagaggggtcggcgctgcagcttctgctgtgacaacgcctgatacggacttgtgcgac
ggcgcgtccgcggaacgttacgctgcgctgtccaccgtgacggaactctga

DBGET integrated database retrieval system