KEGG   Dinoroseobacter shibae: Dshi_1621Help
Entry
Dshi_1621         CDS       T00612                                 

Definition
(GenBank) putative 6-phosphofructokinase isozyme 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00010  Glycolysis / Gluconeogenesis
dsh00030  Pentose phosphate pathway
dsh00051  Fructose and mannose metabolism
dsh00052  Galactose metabolism
dsh00680  Methane metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
dsh01200  Carbon metabolism
dsh01230  Biosynthesis of amino acids
Module
dsh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_1621
   00030 Pentose phosphate pathway
    Dshi_1621
   00051 Fructose and mannose metabolism
    Dshi_1621
   00052 Galactose metabolism
    Dshi_1621
  Energy metabolism
   00680 Methane metabolism
    Dshi_1621
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dshi_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABV93363
RoseoBase: Dshi_1621
UniProt: A8LKZ9
Position
complement(1685849..1686799)
Genome map
AA seq 316 aa AA seqDB search
MTRIVTLTLNPALDSSTDAEHVAPDLKLRCSAPRADAGGGGVNVSRAIAFLGGQSLAALA
LGGGPGERVRQLLRVEGIPVHDLGVAVETRQNLSVIARDTGAQYRFIMPGQTWTDVDVDR
SCEALCKLARAGDLIVPSGSLPPGVGPGDLVALTNRLAVLGVRIVLDTSGAALQAFATGR
AKTLHVLRMDLEEAQSLAGRDLDTVADVAQFGRELVDAGAAKSVIVAKGAEGSILVTSRG
QGWHVRPPKVNVVSKTGAGDSFVAGFTLALAQGSSDLEATVRGVGAAASAVTTPDTDLCD
GASAERYAALSTVTEL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgtattgtgacgctgacactcaatccagccttggattcgtcgaccgatgccgaa
cacgttgcgccggacctgaaacttcgctgctctgcgccccgcgccgatgcggggggcgga
ggcgtcaatgtctccagagccattgcgtttctcggcggacaatctcttgcggcgctcgcg
cttggcggcgggccaggggagcgggttcgacagcttcttcgagtggagggtattccggtg
catgatctcggcgtggctgtggaaacgcgccagaacctgtcggtcatcgcgcgggatacc
ggcgcgcagtatcgcttcatcatgcccggacagacctggacggacgtggatgttgatcga
tcatgtgaggcgctctgcaaactggcgagggccggggatctgatcgtgccatcgggcagc
ttaccaccaggtgtcggcccgggtgatctcgtagcgctgaccaatcgccttgctgtgctg
ggagttcggatcgttcttgatacgtccggggccgctttgcaggccttcgcaacaggaagg
gccaaaacccttcatgtgctgcggatggatctcgaggaagcacagtcgcttgcaggccgg
gacctcgacacagttgcggatgtggcgcagttcgggcgggagctggtggacgcgggggct
gcaaaaagcgtgattgtagccaagggagcggaaggcagtattcttgtcacatcacgcggg
cagggctggcatgtgcgccccccaaaggtgaacgtggtcagcaagaccggtgctggagac
agttttgtggcggggttcacgctggctctcgcacaaggttcgtccgatctggaagcgact
gtgagaggggtcggcgctgcagcttctgctgtgacaacgcctgatacggacttgtgcgac
ggcgcgtccgcggaacgttacgctgcgctgtccaccgtgacggaactctga

DBGET integrated database retrieval system