KEGG   Dinoroseobacter shibae: Dshi_1655Help
Entry
Dshi_1655         CDS       T00612                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00010  Glycolysis / Gluconeogenesis
dsh00052  Galactose metabolism
dsh00500  Starch and sucrose metabolism
dsh00520  Amino sugar and nucleotide sugar metabolism
dsh00521  Streptomycin biosynthesis
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
dsh01200  Carbon metabolism
Module
dsh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dsh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_1655 (glk)
   00052 Galactose metabolism
    Dshi_1655 (glk)
   00500 Starch and sucrose metabolism
    Dshi_1655 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Dshi_1655 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dshi_1655 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dshi_1655 (glk)
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dshi_1655 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABV93397
RoseoBase: Dshi_1655
UniProt: A8LLL9
Position
1721208..1722179
Genome map
AA seq 323 aa AA seqDB search
MTSLRDAPALVADIGGTNTRVALADGPVLRAGSVEKYRNADYSSLDSVLRSYLEKMEVAG
CSGACVALAGPVRNGIGHLTNLDWRMDEDLLSEATGAPVVALLNDLQAQGFALGHLEAAC
LRPVISRPPPAAQETRLMIGLGTGFNAASVLYTPAGRIVTPSEAGHANLPVRTEQELRLC
RFVETAHGFPAVEDVLSGRGLERVYNFLSPTPDQPQRLSAAEVMAAAAREERQALDALEL
FIGLLGTVAGNLSLIHLPFGGVYLCGGVARHIGPYLGSMGFAEAFANKGRFADFMRDFPV
WLVEDDFAALTGCASFLDERCRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacttccttgcgagacgcccctgcccttgtggccgatatcggtggcacgaacacccgc
gtggcgctggccgacggcccggtcctgcgcgcaggcagcgtcgagaagtaccgcaacgcg
gactactcgtctctcgacagcgttctgcggagctatctggagaagatggaagtcgccggt
tgcagcggcgcctgcgtggcgcttgccggaccagtgcgcaatgggatcggccacctgacc
aatctcgactggcgcatggacgaggacctgctgtcggaggccaccggggcaccggtggtg
gccctgctgaacgacttgcaagcgcaagggttcgccttgggtcatctggaagctgcttgc
ctgcgcccggtgatctcgcgccctccccccgccgcgcaagaaacccgcctgatgatcggc
ctcggtaccgggttcaacgccgcgagtgttctctacactcccgcgggccgcatcgtgacc
ccgtcggaggccgggcatgcaaaccttcccgtacgcaccgaacaggagttgcgcctatgt
cgcttcgtagagaccgcccacggcttccccgcagtcgaggacgtgctctcggggcgcgga
ctggagcgggtttataacttcctcagcccgacacccgatcagccgcagcgcctgtccgcc
gccgaggtcatggccgccgccgcccgcgaggagcggcaagcactggatgcgctggaactg
ttcatcggtctgctcgggacggttgcgggcaatctcagcctgatccacctgccattcggg
ggcgtgtatctttgcggcggagtcgcccggcatatcggcccctatctcggctccatgggc
tttgccgaggcctttgccaacaagggccgctttgccgatttcatgcgcgattttccggtg
tggctggtcgaggacgatttcgccgccctgaccggctgcgccagctttctggatgagcgc
tgccgcaactaa

DBGET integrated database retrieval system