KEGG   Dinoroseobacter shibae: Dshi_1655Help
Entry
Dshi_1655         CDS       T00612                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dshi_1655 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_1655 (glk)
   00052 Galactose metabolism
    Dshi_1655 (glk)
   00500 Starch and sucrose metabolism
    Dshi_1655 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Dshi_1655 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dshi_1655 (glk)
   00524 Butirosin and neomycin biosynthesis
    Dshi_1655 (glk)
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dshi_1655 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
1721208..1722179
Genome map
AA seq 323 aa AA seqDB search
MTSLRDAPALVADIGGTNTRVALADGPVLRAGSVEKYRNADYSSLDSVLRSYLEKMEVAG
CSGACVALAGPVRNGIGHLTNLDWRMDEDLLSEATGAPVVALLNDLQAQGFALGHLEAAC
LRPVISRPPPAAQETRLMIGLGTGFNAASVLYTPAGRIVTPSEAGHANLPVRTEQELRLC
RFVETAHGFPAVEDVLSGRGLERVYNFLSPTPDQPQRLSAAEVMAAAAREERQALDALEL
FIGLLGTVAGNLSLIHLPFGGVYLCGGVARHIGPYLGSMGFAEAFANKGRFADFMRDFPV
WLVEDDFAALTGCASFLDERCRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacttccttgcgagacgcccctgcccttgtggccgatatcggtggcacgaacacccgc
gtggcgctggccgacggcccggtcctgcgcgcaggcagcgtcgagaagtaccgcaacgcg
gactactcgtctctcgacagcgttctgcggagctatctggagaagatggaagtcgccggt
tgcagcggcgcctgcgtggcgcttgccggaccagtgcgcaatgggatcggccacctgacc
aatctcgactggcgcatggacgaggacctgctgtcggaggccaccggggcaccggtggtg
gccctgctgaacgacttgcaagcgcaagggttcgccttgggtcatctggaagctgcttgc
ctgcgcccggtgatctcgcgccctccccccgccgcgcaagaaacccgcctgatgatcggc
ctcggtaccgggttcaacgccgcgagtgttctctacactcccgcgggccgcatcgtgacc
ccgtcggaggccgggcatgcaaaccttcccgtacgcaccgaacaggagttgcgcctatgt
cgcttcgtagagaccgcccacggcttccccgcagtcgaggacgtgctctcggggcgcgga
ctggagcgggtttataacttcctcagcccgacacccgatcagccgcagcgcctgtccgcc
gccgaggtcatggccgccgccgcccgcgaggagcggcaagcactggatgcgctggaactg
ttcatcggtctgctcgggacggttgcgggcaatctcagcctgatccacctgccattcggg
ggcgtgtatctttgcggcggagtcgcccggcatatcggcccctatctcggctccatgggc
tttgccgaggcctttgccaacaagggccgctttgccgatttcatgcgcgattttccggtg
tggctggtcgaggacgatttcgccgccctgaccggctgcgccagctttctggatgagcgc
tgccgcaactaa

DBGET integrated database retrieval system