KEGG   Dinoroseobacter shibae: Dshi_1735Help
Entry
Dshi_1735         CDS       T00612                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dsh  Dinoroseobacter shibae
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dshi_1735 (speB)
Enzymes [BR:dsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Dshi_1735 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1801557..1802531)
Genome map
AA seq 324 aa AA seqDB search
MALEDAGGEVDGAFTRPDPRGLSYEAAYGGALSFLRRRYTKELSGVDVAVSGVPFDLSVT
NRPGCRLGPRAIREASSLQPFDPPYGWGFDPLSEFTVVDYGDLAFDYGRAAGFPAALEAH
IRTILAAGAAPLTMGGDHYISYPILRALAEVHGPLSLLQFDAHSDTWPDEDRDRLDHGTM
FYKAVKDGLIDPARSVQVGIRTTNDTDLGFHVIDAREVHEAGAAAVAAKVRGILGDHKTY
LTFDIDCLDPGTAPGTGTPVWGGLSAGQAAILLRDLAGITVVGGDVVEVSPPYDPSGATA
VAGAHVMTEILCLWAWTRRKGGQA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgaagatgcgggcggcgaggtcgatggcgccttcacccgtcccgacccgcgc
ggtctgagctatgaggcggcctatggcggcgcgctgagcttcctgcgccgccgctacacc
aaggagctgagcggcgtggatgtcgcggtctccggcgtgcccttcgatctgtcggtgacc
aatcggcccggctgtcggctgggcccccgcgcgatccgcgaggcgtcgtcgctgcaaccc
ttcgatccgccctatggctgggggttcgacccgctgtcggagttcaccgtggtggattac
ggcgatctggccttcgattacggtcgcgcggcggggttcccagcggcgctcgaggcccat
atccgcaccattctggcggctggcgccgcgccgctgaccatgggcggggaccattatatc
agctatccgatcctgcgcgcgctggccgaggtccacgggcccttgtcgcttctgcagttc
gatgcccattccgacacctggcctgacgaggatcgcgaccggctggatcacgggaccatg
ttctacaaggcggtgaaggacgggctgatcgatcctgcgcgctcggtgcaggtggggatc
cgcaccaccaacgataccgatctcggcttccacgtaatcgacgcccgcgaggtgcacgaa
gcgggcgccgcggccgtggcggccaaggtccggggcatcctgggcgatcacaagacctac
ctgaccttcgacatcgactgcctcgatccgggcaccgccccgggtacgggcacgccggtc
tgggggggcttgagcgcggggcaggcggcgatcctgctgcgcgacctggcgggcatcacc
gtggtgggcggcgacgtggtcgaggtctctccgccctatgatccgtccggggcgacggcg
gtggcaggcgcccatgtgatgacggaaatcctgtgcctctgggcctggacacgccgcaag
ggcgggcaagcctga

DBGET integrated database retrieval system