KEGG   Dinoroseobacter shibae: Dshi_1800Help
Entry
Dshi_1800         CDS       T00612                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01130  Biosynthesis of antibiotics
dsh01230  Biosynthesis of amino acids
Module
dsh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dshi_1800 (trpC)
Enzymes [BR:dsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dshi_1800 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABV93542
RoseoBase: Dshi_1800
UniProt: A8LMJ7
Position
1872395..1873210
Genome map
AA seq 271 aa AA seqDB search
MTDTILDRIKAYKLEEVAARKAARPLAEVEAAARQASPVRPFAGALRAAAQNGYALIAEV
KKASPSKGLIRADFDPPAIARAYAAGGAACLSVLTDAPSFQGHEDYLVAARAACALPVLR
KDFMYDPYQVPEARAMGADCILIIMASVSDAQAVELEDAATSWGMDALIEVHDGDELDRA
LRLNSPLMGINNRNLKTFETTLDTTRTLAPRIPGDRMIVAESGLSGPTELADLAGYGART
FLIGESLMRQADVAEATRALLANPVPVEGAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccattctcgaccggatcaaggcctacaagctggaggaagtggccgcgcgc
aaggccgcccgccccctggcggaggtcgaggcggccgcgcgccaagcctcccccgtccgg
cccttcgcgggcgcgctgcgggcggcggcccagaacggttatgccctgatcgcggaggtc
aagaaggcgagcccctccaagggtctgatccgcgccgatttcgacccgcccgcgattgcc
cgcgcttacgcggccgggggcgcggcctgcctgtcggtgctgaccgatgcgccgagcttc
caggggcatgaggactacctcgtggcggcgcgcgcggcctgcgccctgcccgtcctgcgc
aaggatttcatgtatgacccctaccaggtgcccgaggcccgggcgatgggcgcggactgc
atcctgatcatcatggccagcgtgtcggacgcccaggccgtcgagttggaggatgccgcg
acaagctggggcatggatgcactgatcgaggtgcatgacggcgacgaactggaccgcgcc
ctgcggctgaactcgcccctgatggggatcaacaaccgcaacctcaagacgttcgagacg
accttggacaccacccgcaccctggcgccgcgtatccccggcgaccggatgatcgtggcg
gaatcgggcctgagcgggccgacggagcttgccgatctcgcgggctacggcgcgcgcacc
ttcctcattggcgaaagcctgatgcggcaggcggatgtggccgaggccacgcgcgcgctg
ctcgccaacccggttcccgtggagggcgcggcatga

DBGET integrated database retrieval system