KEGG   Dinoroseobacter shibae: Dshi_1824Help
Entry
Dshi_1824         CDS       T00612                                 

Definition
putative sucrose phosphorylase (EC:2.4.1.-)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
dsh  Dinoroseobacter shibae
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dsh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(1902502..1904265)
Genome map
AA seq 587 aa AA seqDB search
MTELKPLRKPTQTLSVRLSELLRQIYPDLNTDILSSQVLDAFFPEGTGRRKRARTPGNNL
WSEHDAVLITYGNSLMDGVHKPLDLLHDFLVEYLKGVVNGVHILPFFPFTSDDGFAVTDY
RAVNPTLGDWPDINRIADEFLLMSDLVLNHVSSQGAWFNAYRQGHAPYDRFFFEASPEDD
LSDVVRPRTTPLLQQVETANGPRHVWCTFSHDQIDLDFRNPEVLLEFLRIMRLHIDNGVR
IIRLDAVAFIWKVIGTPSIHLPQTHAIVRLMRLLCDFAQEPVILLTETNVPNAENLSYFG
NRNEAHAVYNFTLPPLVLHAMMSGTATYLNRWSTGMPPAQLGCAYLNFTASHDGIGMRPA
EGVLPEDEKARVIDTVRDLGGLVSMRALPGGGESPYELNITFFEAMGATYKGRDDYQVAR
FLCSQTIVMSLEGIPAFYIHSMLATPNDHDQVTRRGMNRAINRHNWDYPHLKALLHDPDT
VQAQVLGALSDRLRLRARQSAFHPNATQFTLQLDPRIFGVWRQSLDRHQSIFALHNVSDE
TVVVSPAAINLIEGEGWHDLLSGEAIRNGGAEIVLAPYQCRWISNRG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattgaagccgctccgcaaaccgacccagaccctcagcgtccgtctttccgaa
ctgctccggcagatctacccggacctgaacaccgatatcctgagcagccaggtgctcgac
gccttcttccccgaaggcaccgggcggcgcaaacgggcgcgcacgccgggcaacaacctg
tggtcggagcacgacgcggtgctgatcacctatggcaactcgctgatggacggggtgcac
aagccgctcgacctgctgcacgacttcctggtggagtatctcaagggcgtggtcaacggc
gtgcatatcctgccgttcttcccgttcacctccgatgacgggttcgcggtcaccgactac
cgcgcggtgaacccgacgctcggggactggcccgatatcaaccgcatcgccgacgagttc
ctgctgatgtcggacctggtgctgaaccatgtctccagccagggcgcatggttcaacgcc
taccgccaggggcacgccccctatgaccggttcttcttcgaagcctcccccgaggacgac
ctgtcggacgtggtccgtccgcgcaccacgccgctgctgcaacaggtcgagaccgccaac
gggccgcgccatgtctggtgcaccttcagccatgaccagatcgacctggatttccgcaac
cccgaggtgctgctggaattcctgcgcatcatgcggctgcatatcgacaatggcgtgcgg
atcatccggctcgacgcggtggccttcatctggaaggtgatcggcaccccctcgatccac
ctgccgcaaacccacgccatcgtccggctgatgcgcctgctgtgcgacttcgcgcaggag
ccggtgatcctgctcactgagaccaacgtgcccaatgccgagaacctgagctatttcggc
aaccgcaacgaggcgcacgcggtctacaacttcaccctgccgccccttgtgctgcatgcg
atgatgtcgggcacggcgacctatctcaaccgctggagcacggggatgccgcccgcgcag
ctcggctgtgcctacctgaacttcaccgcctcccatgacgggatcgggatgcgcccggcc
gagggcgtgctgcccgaggacgagaaggcccgcgtgatcgacaccgtgcgcgatctcggc
gggctggtctccatgcgcgcgctgccgggcggcggcgagagcccttacgagctcaacatc
accttcttcgaggcgatgggcgccacctacaagggccgcgacgactaccaggtcgcgcgc
ttcctctgctcccagaccatcgtgatgtccctcgaaggcatcccggccttctacatccat
tccatgctggccacgcccaacgaccacgatcaggtcacgcggcgcggcatgaaccgggcg
atcaaccggcacaactgggactacccgcatctcaaggcgctgctgcacgatcccgacacg
gtccaagcgcaagtgctgggcgcgctgtcggaccggctgcggctgcgggcgcgccaatcg
gccttccaccccaacgccacgcaattcaccctgcaactggacccgcgcatcttcggtgtc
tggcgtcaaagcctcgaccggcaccagtcgatcttcgccctgcacaatgtcagcgacgag
accgtcgtggtctcccccgccgcgatcaacctgatcgaaggcgagggctggcacgacctg
ctgagcggcgaagcgatccgcaacggcggcgccgaaatcgtgctcgccccctaccagtgc
cgctggatctcgaaccggggctga

DBGET integrated database retrieval system