KEGG   Dinoroseobacter shibae: Dshi_1976Help
Entry
Dshi_1976         CDS       T00612                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dsh  Dinoroseobacter shibae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dshi_1976
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dshi_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2089743..2090660)
Genome map
AA seq 305 aa AA seqDB search
MGKPIVILGIFVADCAFRAARPPRMGETVLGDSFALNPGGKGSNQAIAAAKSGGDARFLT
RLGEDAFADMAAAIWAEAGVRATAPRDPASYTGAAYIYVDPATGDNAIIVAPGAAALLGP
ADLDAQAEMIGGAGVFLTQLEQPMPAARRGLEIARAAGVTTILNPAPAAPLDDALLALCD
IVTPNETEAEALTGHPVTGPDDAVRAADALLARGPGAVIVTLGAQGVLYRSATQTIHQPA
FTPGPVVETTGAGDAFNGALATALAEGQDTASALRFGCATASISVTRPGAGPSMPSRAEI
DALLA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaccgatcgtcattctgggtatcttcgtggccgattgcgcctttcgtgccgcg
cgcccgccgcgcatgggcgagaccgttctgggcgacagcttcgcgctgaaccccggcggc
aagggctccaaccaggccatcgccgcggcgaaatccggcggcgacgcacggtttctgaca
cgcctcggggaggatgcctttgccgacatggccgcggcgatctgggccgaggcgggggtg
cgggccaccgcgccgcgcgatccggccagctataccggggcggcctatatctatgtcgac
ccggcgaccggcgacaacgcgatcatcgtggctccgggggcggcggcgctgctcggccct
gcggacctcgacgcgcaggcggagatgatcggcggggcgggcgtgtttctgacgcagctc
gaacagcccatgcccgccgcccgccgcgggctcgagatcgcccgcgctgccggtgtcacc
acgatcctcaaccccgcccccgcagcccccctcgacgacgcgctgctggcgctttgcgat
atcgtcacgccgaacgagaccgaggcggaggcgctcaccggccaccccgtcaccggcccc
gacgacgcggtgcgggccgccgatgccctgctggcgcggggcccgggggctgtgatcgtc
accctcggcgcgcagggcgttctctatcgtagcgccacgcagaccatccaccagcccgcc
ttcacccctgggccggtggtcgagaccacgggcgcgggcgatgcgttcaacggggcgctg
gcgacggccctggccgagggacaggacaccgcctcggccctgcgcttcggctgcgcgacc
gcgtcgatctcggtcacccgtcccggcgcggggccgtccatgccgagccgcgccgagatc
gacgccctgctggcctga

DBGET integrated database retrieval system