KEGG   Dinoroseobacter shibae: Dshi_2055Help
Entry
Dshi_2055         CDS       T00612                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dshi_2055
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dshi_2055
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dshi_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2174739..2175272)
Genome map
AA seq 177 aa AA seqDB search
MAVVGLVAASSVAARPATSDPLPDGAGAFMAIEGVPLNLSDWAGQPVLVVNTASRCGFTD
QYAGLQALQDRYGTDRLTVLAVPSDSFNQEFATAEEVAEFCALNYDLTLPMTDITPVRGT
GAHPFYDWLAETQNVVPRWNFTKILLDGEGRFVAHFDTATRPLSPRITREIDALITR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtggtcgggcttgtcgcggccagcagcgtggccgcccggccggcgacctccgac
cctttgccggacggggccggggccttcatggcgattgagggcgtgcccttgaacctgtcc
gactgggccgggcagccggttctggtggtcaataccgcatcgcgttgcggtttcaccgat
cagtacgcgggtctgcaggcgctccaggaccgttacggcaccgacaggctgaccgttctg
gcggtgccctcggacagcttcaaccaggaatttgccacggccgaagaggtcgcggagttc
tgtgcgctgaactatgatctgacgctgccgatgaccgacatcaccccggtgcgcggcacc
ggggcgcatcctttctatgattggctggccgagacacagaacgtcgtgccccggtggaat
ttcacgaagatcctgctcgatggcgaagggcggttcgtggcccatttcgacaccgcaacg
cggcccctctcgccccggatcacgcgggaaatcgacgccttgattacccggtga

DBGET integrated database retrieval system