KEGG   Dinoroseobacter shibae: Dshi_2078Help
Entry
Dshi_2078         CDS       T00612                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dshi_2078 (tpiA)
   01230 Biosynthesis of amino acids
    Dshi_2078 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_2078 (tpiA)
   00051 Fructose and mannose metabolism
    Dshi_2078 (tpiA)
   00562 Inositol phosphate metabolism
    Dshi_2078 (tpiA)
Enzymes [BR:dsh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dshi_2078 (tpiA)
Exosome [BR:dsh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dshi_2078 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dshi_2078 (tpiA)
  Exosomal proteins of melanoma cells
   Dshi_2078 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
2198730..2199473
Genome map
AA seq 247 aa AA seqDB search
MRRKLAAGNWKMNGLRAALAEAEAITAAAAADGPEVLLCPPATLLAPMAAQAEGTALQIG
GQYCHPAPSGAHTGHVSAPMLRDAGASYVIVGHSERRQDDGERDADVRAQTLAAWQAGLT
AIVCVGETEAERDAANTLAIIGGQLAGSIPDTATGANLVVAYEPVWAIGTGRVPSVDQIG
EVHDFIRARLEQRFGEGVGRSVRLLYGGSVKPGIAAEIFAVSNVDGALVGGASLKAADFT
GIIAALG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggaaactggcggcgggaaactggaagatgaacgggctgcgcgcggccctcgcg
gaagcggaggcgatcacggccgcggccgctgcggacggacccgaggtcctgctctgcccg
cccgcgacgctcctggcgcccatggcggcgcaggccgagggcaccgccctgcagatcggc
gggcagtattgccatcccgccccctcgggcgcccatacgggccatgtctcggcgccgatg
ctgcgcgatgccggggccagctacgtgatcgtggggcattccgaacggcgccaggacgac
ggcgagcgcgacgcggatgtgcgcgcccagacgctcgcggcctggcaagccgggctgacc
gccatcgtctgcgtgggcgagaccgaggccgaacgcgatgccgccaacacgctggcgatc
atcggcgggcaactggcgggctccatccccgataccgccacgggtgccaatctcgtggtg
gcctatgagccggtctgggccatcggcacgggccgggtgcccagcgtcgaccagatcggc
gaggtgcatgatttcatccgcgcgcgactggaacaacgtttcggcgaaggcgtggggcgg
tcggtacggctgctctatggcggctcggtcaaacccggcatcgccgccgagatcttcgcc
gtgtccaacgtggacggggcgcttgtgggcggcgcatccctgaaggcggcggatttcacc
gggatcatcgccgcactgggctga

DBGET integrated database retrieval system