KEGG   Dinoroseobacter shibae: Dshi_2078Help
Entry
Dshi_2078         CDS       T00612                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00010  Glycolysis / Gluconeogenesis
dsh00051  Fructose and mannose metabolism
dsh00562  Inositol phosphate metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
dsh01200  Carbon metabolism
dsh01230  Biosynthesis of amino acids
Module
dsh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dsh_M00002  Glycolysis, core module involving three-carbon compounds
dsh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_2078 (tpiA)
   00051 Fructose and mannose metabolism
    Dshi_2078 (tpiA)
   00562 Inositol phosphate metabolism
    Dshi_2078 (tpiA)
Enzymes [BR:dsh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dshi_2078 (tpiA)
Exosome [BR:dsh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dshi_2078 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dshi_2078 (tpiA)
  Exosomal proteins of melanoma cells
   Dshi_2078 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM MtrG
Motif
Other DBs
NCBI-ProteinID: ABV93815
RoseoBase: Dshi_2078
UniProt: A8LPW1
Position
2198730..2199473
Genome map
AA seq 247 aa AA seqDB search
MRRKLAAGNWKMNGLRAALAEAEAITAAAAADGPEVLLCPPATLLAPMAAQAEGTALQIG
GQYCHPAPSGAHTGHVSAPMLRDAGASYVIVGHSERRQDDGERDADVRAQTLAAWQAGLT
AIVCVGETEAERDAANTLAIIGGQLAGSIPDTATGANLVVAYEPVWAIGTGRVPSVDQIG
EVHDFIRARLEQRFGEGVGRSVRLLYGGSVKPGIAAEIFAVSNVDGALVGGASLKAADFT
GIIAALG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggaaactggcggcgggaaactggaagatgaacgggctgcgcgcggccctcgcg
gaagcggaggcgatcacggccgcggccgctgcggacggacccgaggtcctgctctgcccg
cccgcgacgctcctggcgcccatggcggcgcaggccgagggcaccgccctgcagatcggc
gggcagtattgccatcccgccccctcgggcgcccatacgggccatgtctcggcgccgatg
ctgcgcgatgccggggccagctacgtgatcgtggggcattccgaacggcgccaggacgac
ggcgagcgcgacgcggatgtgcgcgcccagacgctcgcggcctggcaagccgggctgacc
gccatcgtctgcgtgggcgagaccgaggccgaacgcgatgccgccaacacgctggcgatc
atcggcgggcaactggcgggctccatccccgataccgccacgggtgccaatctcgtggtg
gcctatgagccggtctgggccatcggcacgggccgggtgcccagcgtcgaccagatcggc
gaggtgcatgatttcatccgcgcgcgactggaacaacgtttcggcgaaggcgtggggcgg
tcggtacggctgctctatggcggctcggtcaaacccggcatcgccgccgagatcttcgcc
gtgtccaacgtggacggggcgcttgtgggcggcgcatccctgaaggcggcggatttcacc
gggatcatcgccgcactgggctga

DBGET integrated database retrieval system