KEGG   Dinoroseobacter shibae: Dshi_2160Help
Entry
Dshi_2160         CDS       T00612                                 

Gene name
pdhC1
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00010  Glycolysis / Gluconeogenesis
dsh00020  Citrate cycle (TCA cycle)
dsh00620  Pyruvate metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
dsh01200  Carbon metabolism
Module
dsh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_2160 (pdhC1)
   00020 Citrate cycle (TCA cycle)
    Dshi_2160 (pdhC1)
   00620 Pyruvate metabolism
    Dshi_2160 (pdhC1)
Enzymes [BR:dsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dshi_2160 (pdhC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABV93896
RoseoBase: Dshi_2160
UniProt: A8LQM9
Position
2289232..2290494
Genome map
AA seq 420 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWMVKEGDSVSSGDLLAEIETDKATMEFEAVDDGIIGKIL
VAAGTDDVKVNTLIAILLEEGEELGAEKPAEQPPEPASVQQEAAPQETAKAPPPKTGDRV
FASPLARRLAKQKGLDLSEIRGSGPHGRIVKADVDAAEQPAAVPEQAAAPQTRQPEGPKS
ASSVASIFADRPFTEVSLDGMRKTIAARLTEAKQTIPHFYLRRAANLDALLTFRTELNAQ
LAPSGKKLSVNDFVIKACARALQSVPHANAVWAEDRILQMQRSDVAVAVAIEGGLFTPVI
KDADQKSISALSEEMKDLAARARERKLAPSEYVGGTFAISNLGMFGIENFDAVINPPHGA
ILAVGAGVKKPTVDADGAVTVATQMSMTLSVDHRVIDGSVGAALLAEIVSGLENPLLLLA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgagattctgatgcctgcgctgtctccgaccatggaggaaggcacgctcgcg
aaatggatggtcaaggaaggcgacagcgtctcgtccggagacctgctcgccgaaatcgag
accgacaaggccacgatggagttcgaggctgttgatgatggcatcatcggcaagatcctc
gttgctgcgggcacggacgatgtgaaggtcaacacgctcatcgcgatcctgctcgaagag
ggcgaggagctcggcgcggagaagcctgcggagcaaccgccggagcccgcctccgtccaa
caagaggccgccccgcaagagactgccaaagcaccgccgccaaaaaccggagatcgtgtg
ttcgccagccccctcgcccggcgcctggcaaaacagaaaggtctggacctttccgagatc
cggggctcaggtccgcatggccgcatcgtgaaggcagatgtagatgccgcagaacagccg
gctgccgttccggaacaggctgccgcaccccaaacccgccagccagagggtccgaaatcg
gcttcgtccgtagcatcgatcttcgcggatcgtcccttcaccgaagtttcgctcgatggc
atgcgaaagaccatcgccgcgcgcctgacggaggccaaacagacgatcccgcatttctac
ctgcgcagagcggccaatcttgatgccctgctgactttccgaaccgagttgaatgcgcaa
ctcgcgcccagcggcaagaaactgagcgtcaatgatttcgtgataaaggcctgtgcccga
gcactgcagagcgtgccccacgccaatgctgtctgggcagaggaccgcatcctgcagatg
cagaggtccgatgtcgcggttgcagtggcgatcgagggcggcctgttcacgcccgtgatc
aaggatgcggatcaaaagtcgatttccgccctttcagaggaaatgaaagacctcgcagcc
cgcgcgcgcgagcgcaaacttgcgccgagtgaatatgtcggcggtaccttcgccatttcc
aatctcggcatgttcggaatcgagaatttcgacgcggtgatcaacccaccccacggggcc
attctcgccgtgggggcaggtgtcaaaaagccgaccgtcgacgcggatggggctgtaaca
gttgcgacgcagatgtccatgacgctgtcggtggaccaccgcgtcatcgacggctcggtt
ggcgccgcacttctggcagagatcgtatcaggcctcgaaaacccgcttcttcttctggca
tag

DBGET integrated database retrieval system