KEGG   Dinoroseobacter shibae: Dshi_2404Help
Entry
Dshi_2404         CDS       T00612                                 

Gene name
glyQ
Definition
glycyl-tRNA synthetase subunit alpha (EC:6.1.1.14)
Orthology
K01878  
glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
dsh  Dinoroseobacter shibae
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:dsh00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2540624..2541607)
Genome map
AA seq 327 aa AA seqDB search
MTLPGLLPIENAALIKGIPMDTPRSFQEIILRLQAYWADQGCAVLQPYDMEVGAGTFHPA
TTLRALGSRPWAAAYVQPSRRPTDGRYGENPNRLQHYYQYQVIIKPSPPDLQELYLGSLR
AIGIDAALHDIRFVEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCRPVSGEL
TYGLERLAMYVLGVDHVMDMPFNAPDAAIPLSYGDVFRQTEAEYSRWNFDQADTATLLKH
FEEAEAECAAALAAPHQDPKTGKRILMVHPAYDQCIKASHLFNLLDARGVISVTERQAYI
GRVRALAKACADAFVQTEAGGWTPAPA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgaccctgccggggctgttgcctattgagaacgcggctctgatcaaaggcatccccatg
gacaccccccgctcgttccaggaaatcattctacgcctgcaggcctactgggccgaccag
ggctgcgccgtgctgcaaccctatgacatggaggtgggtgcaggcaccttccacccggcc
accaccctgcgcgcgctgggcagccgcccctgggccgccgcctatgtccagccctcgcgc
cgccccaccgatggccgctacggcgagaaccccaaccggctgcagcactactaccagtac
caggtcatcatcaaacccagcccccccgacctgcaggagctctatctcggctcgctccgt
gccatcggcatcgacgccgccctccacgacatccgctttgtcgaggacgactgggaaagc
cccacgctcggcgcctggggcctgggatgggaggtctggtgcgacggcatggaagtctcg
caattcacctatttccagcaggtcggcggccatgactgccgcccggtctcgggggagctg
acctatggtctcgaacggctggcgatgtatgtgctcggcgtcgatcacgtcatggacatg
cccttcaacgcccccgacgcagccatcccgctgagctatggcgacgtcttccgccagacc
gaggccgagtattcccgctggaacttcgaccaggccgacaccgcgaccctgctcaagcac
ttcgaggaggcggaggccgaatgcgccgccgccctcgcggccccgcaccaagacccgaaa
accggcaaacgcatcctcatggtccacccggcctatgaccagtgcatcaaggccagccac
ctgttcaacctgctggatgcgcgcggcgtgatctcggtcaccgaacgccaggcctatatc
ggccgggtccgcgcgctcgccaaggcctgcgccgatgccttcgtgcaaaccgaggccggc
ggctggacgcctgcgcccgcatga

DBGET integrated database retrieval system