KEGG   Dinoroseobacter shibae: Dshi_2655Help
Entry
Dshi_2655         CDS       T00612                                 

Gene name
ccpA
Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dsh  Dinoroseobacter shibae
Brite
Enzymes [BR:dsh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Dshi_2655 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2810268..2811320)
Genome map
AA seq 350 aa AA seqDB search
MACHPALRFGTVSMLVLAASAASASDLQEQARELFEPVPSTIPALRDNPVTPEKIDLGKA
LFFDPRMSASGVFSCNSCHNLATGGDDNMPVSIGHGWQKGPRNSPTVLNAVFNIAQFWDG
RAEDLAAQAKGPVQAGVEMANTPENVIATLNSMPQYVEWFTASFPEEADPVSFDNFAKAI
EAYEATLITPAPFDAYLNGDEAALSEDQKEGLALFIDKGCASCHNGVNLGGNGYYPFGLI
EKPGADVLPPDDMGRFAVTETADDSYVFRASPLRNIELTAPYFHSGVVWDLKAAVQIMGD
SQLGADITEDEADKIVAFLRALTGEMPEVVYPILPVETAATPRPTGEVLP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtcacccagccctccggtttggcactgtttccatgcttgttctggccgcgtcc
gcggcgtccgcgtccgacctgcaggagcaggcgcgcgagctgttcgagccggtgccctcc
acgatcccggcgctgcgcgacaaccccgtcacgccggagaagatcgacctgggcaaggcg
ctgttcttcgacccgcggatgtccgcgtcgggggtgttttcgtgcaattcctgccacaac
ctggcgacgggcggcgacgacaacatgccggtctcgatcggccatggctggcagaagggg
ccgcgcaactcgcccacggtgctgaacgcggtgttcaacatcgcgcagttctgggacggg
cgggccgaggacctggcagcgcaggccaaggggcctgtgcaggcgggggtcgagatggcc
aacacgccggagaacgtgatcgcgacgctcaactccatgccgcaatatgtggagtggttc
acggcctcctttcccgaagaggccgacccggtgtccttcgacaatttcgctaaggcgatc
gaggcctacgaggccacgctgatcacgcccgcgcccttcgatgcctatctgaacggggac
gaggcggcgctgagcgaggaccagaaggagggcctggcgctcttcatcgacaagggctgc
gcctcttgccataacggggtgaacctgggcggcaacggctactatcccttcgggctgatc
gagaagccgggggcggatgtgctgccgcccgatgacatgggccgattcgcggtgaccgag
acggcggatgattcctatgtcttccgggcctcgcccctgcgcaatatcgagctgacggcg
ccctatttccattccggcgtggtgtgggacctgaaggccgcggtgcagatcatgggcgac
tcgcagctcggtgccgatatcaccgaggatgaggcggacaagatcgtggccttcctgcgc
gccctgaccggggagatgccggaggtggtctatccgatcctgccggtggaaacggcggcg
acgccgcggcccacgggcgaggttctgccctga

DBGET integrated database retrieval system