KEGG   Dinoroseobacter shibae: Dshi_2677Help
Entry
Dshi_2677         CDS       T00612                                 

Definition
lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dsh  Dinoroseobacter shibae
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dshi_2677
Enzymes [BR:dsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dshi_2677
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Dshi_2677
Lipid biosynthesis proteins [BR:dsh01004]
 Fatty acid synthase
  Component type
   Dshi_2677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2834844..2835545)
Genome map
AA seq 233 aa AA seqDB search
MRALRGVASGYGADGGIRKAGAGLAAAASALWLSLAPAWAEPVVVAALGDSLTQGYGLPQ
QDGFVPQLQAWLEAQGEEVTLINAGVSGDTTAGGLSRVDWTLTPEVDALIVALGGNDLLR
GIDPAVSRANLDGILSRAAARGLPVLLVGLEAPGNYGPDYKAAFDAMYPELAAQYGALHE
ESFLAALTAEDDQATALRNYMQSDGIHPNAAGVAKIVAALGPSVQALIARAAP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcattgcggggcgttgcgtctggatatggggcggatggcggcattcgcaaggct
ggcgcgggacttgccgcggccgcgagcgcactgtggctgagccttgcgcccgcctgggcc
gagccggtggtggtcgcggccctgggcgacagcctgacccagggctacgggctgccgcag
caggacgggttcgtgccgcagctgcaggcctggctggaggcgcagggcgaggaggtcacg
ctgatcaatgcgggcgtgtcgggcgataccaccgcgggcgggctgagccgggtggactgg
acgctgacgcccgaggtcgacgcgctgatcgtggcgctggggggcaatgacctgctgcgc
gggatcgacccggcggtgagccgcgccaatctcgacgggatcctgagccgggcggcggcg
cgggggttgccggtgctgctggtggggctggaggcgccgggcaattacggccccgactac
aaggccgcgttcgacgcgatgtatcccgagctggccgcgcaatacggggcactgcacgaa
gagagtttcctggccgccttgaccgccgaggacgaccaggccacggccttgcgcaactac
atgcagagcgacgggatccatcccaatgcggccggggtcgccaagatcgtcgcagcgctc
ggcccctcggtgcaggccctgatcgcccgcgccgcgccctag

DBGET integrated database retrieval system