KEGG   Dinoroseobacter shibae: Dshi_2677Help
Entry
Dshi_2677         CDS       T00612                                 

Definition
(GenBank) lipolytic protein
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dshi_2677
Enzymes [BR:dsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dshi_2677
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Dshi_2677
Lipid biosynthesis proteins [BR:dsh01004]
 Fatty acid synthase
  Component type
   Dshi_2677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK DUF2271
Motif
Other DBs
NCBI-ProteinID: ABV94410
RoseoBase: Dshi_2677
UniProt: A8LIG9
Position
complement(2834844..2835545)
Genome map
AA seq 233 aa AA seqDB search
MRALRGVASGYGADGGIRKAGAGLAAAASALWLSLAPAWAEPVVVAALGDSLTQGYGLPQ
QDGFVPQLQAWLEAQGEEVTLINAGVSGDTTAGGLSRVDWTLTPEVDALIVALGGNDLLR
GIDPAVSRANLDGILSRAAARGLPVLLVGLEAPGNYGPDYKAAFDAMYPELAAQYGALHE
ESFLAALTAEDDQATALRNYMQSDGIHPNAAGVAKIVAALGPSVQALIARAAP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcattgcggggcgttgcgtctggatatggggcggatggcggcattcgcaaggct
ggcgcgggacttgccgcggccgcgagcgcactgtggctgagccttgcgcccgcctgggcc
gagccggtggtggtcgcggccctgggcgacagcctgacccagggctacgggctgccgcag
caggacgggttcgtgccgcagctgcaggcctggctggaggcgcagggcgaggaggtcacg
ctgatcaatgcgggcgtgtcgggcgataccaccgcgggcgggctgagccgggtggactgg
acgctgacgcccgaggtcgacgcgctgatcgtggcgctggggggcaatgacctgctgcgc
gggatcgacccggcggtgagccgcgccaatctcgacgggatcctgagccgggcggcggcg
cgggggttgccggtgctgctggtggggctggaggcgccgggcaattacggccccgactac
aaggccgcgttcgacgcgatgtatcccgagctggccgcgcaatacggggcactgcacgaa
gagagtttcctggccgccttgaccgccgaggacgaccaggccacggccttgcgcaactac
atgcagagcgacgggatccatcccaatgcggccggggtcgccaagatcgtcgcagcgctc
ggcccctcggtgcaggccctgatcgcccgcgccgcgccctag

DBGET integrated database retrieval system