KEGG   Dinoroseobacter shibae: Dshi_2683Help
Entry
Dshi_2683         CDS       T00612                                 

Gene name
mro
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dsh00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dsh00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
2843824..2844828
Genome map
AA seq 334 aa AA seqDB search
MSAEITPFGKTAQGTQVHAITLASDALRVTLLTWGAVIQDVRLTGVAQPLTLGTADLAAY
AGAMNSFGALMGPVVNRIKGAAAPIAGQRHAFEANLDGAHTKHGGSHGPQYRVWHLLESS
PTHALLETVLQDGLSGFPGNRTLRAEYRVNGADLDLVVIGTTDAPTLMNIANHSYWNLDG
SDSIAGHTLQIAADRVTVNGDDLMVTGEVMAVAGTRFDFRRPRAFDPGPENRFDLNYVLA
DAKRPLSHACTLTGTSGVQMEMSTTEPGLQVFDLGTFTTAPHPGHAGTPYPRFAAIALEA
QGWPDAANHAGFPPIEIGPDHPYHQHTRWRFRRP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagaaatcaccccgttcgggaagaccgcccaaggcacgcaggtccacgcgatc
accctcgccagcgacgcgttgcgggtgacgctgctgacctggggcgcggtgatccaggat
gtgcgcctgaccggggtggcgcagccgctgaccctcgggaccgcggatctggccgcctat
gccggggcgatgaacagcttcggcgcgctgatggggccggttgtgaaccggatcaagggg
gccgccgccccgatcgcgggccagcgccacgccttcgaggccaatctcgacggcgcccat
accaagcatggcggcagccacgggccgcaataccgggtctggcacctgctggagagcagc
ccgacccatgccctgctggagacggtgctgcaggacgggctgtcgggctttcccggcaac
cgcaccctgcgcgccgagtaccgggtgaacggcgccgatctggacctggtggtgatcggc
accacggacgccccgaccctgatgaacatcgccaatcacagctactggaacctcgacggc
tccgacagcatcgcgggccatacgctgcagatcgccgcggacagggtgacggtgaacggc
gacgacctgatggtcacgggcgaggtcatggcggtggcgggcacccggttcgacttccgc
aggccccgcgcgttcgacccgggccccgagaaccggttcgacctgaattacgtgctggcc
gatgccaagcggcccctgagccatgcctgcaccctgaccggcacctccggcgtgcagatg
gagatgtccaccaccgagccggggttgcaggtcttcgatctgggcaccttcaccaccgcg
ccccatccgggccatgcgggcacgccctatccgcgcttcgcggccatcgcgctcgaggcg
cagggctggcccgacgcggcgaaccatgcgggcttcccgccgatcgagatcggccccgat
cacccctatcaccagcacacgcgctggcggttccgccgcccctga

DBGET integrated database retrieval system