KEGG   Dinoroseobacter shibae: Dshi_2683Help
Entry
Dshi_2683         CDS       T00612                                 

Gene name
mro
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00010  Glycolysis / Gluconeogenesis
dsh00052  Galactose metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_2683 (mro)
   00052 Galactose metabolism
    Dshi_2683 (mro)
Enzymes [BR:dsh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dshi_2683 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABV94416
RoseoBase: Dshi_2683
UniProt: A8LIH5
Position
2843824..2844828
Genome map
AA seq 334 aa AA seqDB search
MSAEITPFGKTAQGTQVHAITLASDALRVTLLTWGAVIQDVRLTGVAQPLTLGTADLAAY
AGAMNSFGALMGPVVNRIKGAAAPIAGQRHAFEANLDGAHTKHGGSHGPQYRVWHLLESS
PTHALLETVLQDGLSGFPGNRTLRAEYRVNGADLDLVVIGTTDAPTLMNIANHSYWNLDG
SDSIAGHTLQIAADRVTVNGDDLMVTGEVMAVAGTRFDFRRPRAFDPGPENRFDLNYVLA
DAKRPLSHACTLTGTSGVQMEMSTTEPGLQVFDLGTFTTAPHPGHAGTPYPRFAAIALEA
QGWPDAANHAGFPPIEIGPDHPYHQHTRWRFRRP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagaaatcaccccgttcgggaagaccgcccaaggcacgcaggtccacgcgatc
accctcgccagcgacgcgttgcgggtgacgctgctgacctggggcgcggtgatccaggat
gtgcgcctgaccggggtggcgcagccgctgaccctcgggaccgcggatctggccgcctat
gccggggcgatgaacagcttcggcgcgctgatggggccggttgtgaaccggatcaagggg
gccgccgccccgatcgcgggccagcgccacgccttcgaggccaatctcgacggcgcccat
accaagcatggcggcagccacgggccgcaataccgggtctggcacctgctggagagcagc
ccgacccatgccctgctggagacggtgctgcaggacgggctgtcgggctttcccggcaac
cgcaccctgcgcgccgagtaccgggtgaacggcgccgatctggacctggtggtgatcggc
accacggacgccccgaccctgatgaacatcgccaatcacagctactggaacctcgacggc
tccgacagcatcgcgggccatacgctgcagatcgccgcggacagggtgacggtgaacggc
gacgacctgatggtcacgggcgaggtcatggcggtggcgggcacccggttcgacttccgc
aggccccgcgcgttcgacccgggccccgagaaccggttcgacctgaattacgtgctggcc
gatgccaagcggcccctgagccatgcctgcaccctgaccggcacctccggcgtgcagatg
gagatgtccaccaccgagccggggttgcaggtcttcgatctgggcaccttcaccaccgcg
ccccatccgggccatgcgggcacgccctatccgcgcttcgcggccatcgcgctcgaggcg
cagggctggcccgacgcggcgaaccatgcgggcttcccgccgatcgagatcggccccgat
cacccctatcaccagcacacgcgctggcggttccgccgcccctga

DBGET integrated database retrieval system