KEGG   Dinoroseobacter shibae: Dshi_2683Help
Entry
Dshi_2683         CDS       T00612                                 

Gene name
mro
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dsh  Dinoroseobacter shibae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dshi_2683 (mro)
   00052 Galactose metabolism
    Dshi_2683 (mro)
Enzymes [BR:dsh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dshi_2683 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
2843824..2844828
Genome map
AA seq 334 aa AA seqDB search
MSAEITPFGKTAQGTQVHAITLASDALRVTLLTWGAVIQDVRLTGVAQPLTLGTADLAAY
AGAMNSFGALMGPVVNRIKGAAAPIAGQRHAFEANLDGAHTKHGGSHGPQYRVWHLLESS
PTHALLETVLQDGLSGFPGNRTLRAEYRVNGADLDLVVIGTTDAPTLMNIANHSYWNLDG
SDSIAGHTLQIAADRVTVNGDDLMVTGEVMAVAGTRFDFRRPRAFDPGPENRFDLNYVLA
DAKRPLSHACTLTGTSGVQMEMSTTEPGLQVFDLGTFTTAPHPGHAGTPYPRFAAIALEA
QGWPDAANHAGFPPIEIGPDHPYHQHTRWRFRRP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagaaatcaccccgttcgggaagaccgcccaaggcacgcaggtccacgcgatc
accctcgccagcgacgcgttgcgggtgacgctgctgacctggggcgcggtgatccaggat
gtgcgcctgaccggggtggcgcagccgctgaccctcgggaccgcggatctggccgcctat
gccggggcgatgaacagcttcggcgcgctgatggggccggttgtgaaccggatcaagggg
gccgccgccccgatcgcgggccagcgccacgccttcgaggccaatctcgacggcgcccat
accaagcatggcggcagccacgggccgcaataccgggtctggcacctgctggagagcagc
ccgacccatgccctgctggagacggtgctgcaggacgggctgtcgggctttcccggcaac
cgcaccctgcgcgccgagtaccgggtgaacggcgccgatctggacctggtggtgatcggc
accacggacgccccgaccctgatgaacatcgccaatcacagctactggaacctcgacggc
tccgacagcatcgcgggccatacgctgcagatcgccgcggacagggtgacggtgaacggc
gacgacctgatggtcacgggcgaggtcatggcggtggcgggcacccggttcgacttccgc
aggccccgcgcgttcgacccgggccccgagaaccggttcgacctgaattacgtgctggcc
gatgccaagcggcccctgagccatgcctgcaccctgaccggcacctccggcgtgcagatg
gagatgtccaccaccgagccggggttgcaggtcttcgatctgggcaccttcaccaccgcg
ccccatccgggccatgcgggcacgccctatccgcgcttcgcggccatcgcgctcgaggcg
cagggctggcccgacgcggcgaaccatgcgggcttcccgccgatcgagatcggccccgat
cacccctatcaccagcacacgcgctggcggttccgccgcccctga

DBGET integrated database retrieval system