KEGG   Dinoroseobacter shibae: Dshi_2749Help
Entry
Dshi_2749         CDS       T00612                                 

Definition
putative cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dsh  Dinoroseobacter shibae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2910830..2912143)
Genome map
AA seq 437 aa AA seqDB search
MKRALHILAFLCAGPAVAEVPPPLSPADFHAFDPDQARIGQLLFYDKILSGNRNIACGTC
HHHDHAGGDGLSLGIGEGGVGVGPERTAGTGADRIRKRIPRNAPALWNLGHKDIRVLFHD
GRLEVSELYGNGFNSPAQEWLPTGFDHILAAQAVLPLVAQFEMAGNPKENEIAGAVHDRI
DAAWPILAKRVRTIPEYGAMFVDAFDHVETPEQVTIVEIANALAAFIGTEWANYDSPFDA
YLAGDAGALDAAAARGMALFYGAAGCATCHSGPLLSDQKFHALGLPAFGPGRTRQWDPIP
RDMGRVGESNRLEDAYRFRTPPLRNVALTGPYGHNGAYRTLEGIVRHHLDPGGMGAAWRP
QDAQLPEAPWLAEIDFVIRSDRAEMARQAAARDIAPVALDDAQVADLVAFLHALTGRTAE
ARPLGRPETVPSGLPVD
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgcgctgcatatcctcgcctttctttgtgccgggcccgcggtggcggaggtg
ccgccgccgctgtcgcctgcggatttccacgcgttcgacccggatcaggcccggatcggt
cagcttctgttttacgacaagatcctgtcgggcaacaggaacatcgcttgcgggacctgt
caccaccatgaccacgcgggcggcgacgggctgagcctggggatcggcgaggggggcgtg
ggtgtcgggccggagcggacggcaggaaccggcgcggatcgtatccgcaagcggatcccg
cgcaacgcccccgccctgtggaacctcgggcacaaggacatccgggtgctgttccatgac
gggcggcttgaggtgtcggagctttatggaaatgggttcaactcgcctgcgcaggaatgg
ctgcccacggggttcgaccatatccttgcggcgcaggcggtgctgccgttggtggcgcag
ttcgagatggcgggaaatcccaaggagaacgagatcgccggtgcggtgcatgaccggatc
gacgcggcctggccgatcctggccaagcgggtgcggacgatcccggaatacggcgcgatg
ttcgtggacgcgtttgaccatgtcgagacgcccgagcaggtcacgattgtcgagatcgct
aatgcgctggcggcgttcatcggcacggaatgggccaattacgacagcccgttcgacgcc
tacctggccggggatgcgggcgcgctcgacgcagcggcggcgcgagggatggcgttgttc
tacggggcggccgggtgcgcgacgtgtcattccgggcccttgctgagcgaccagaagttt
catgcgctgggcctgccggccttcggccccgggcgcacgcggcaatgggatccgatcccg
cgtgacatgggccgggtgggggagagcaaccggctggaggatgcctaccggttccgcacg
ccgcccctgcgcaatgtcgcgctgaccgggccctacggccataacggggcctaccggacg
ctggaggggatcgtgcgccaccatctcgacccgggtgggatgggggcggcctggagaccg
caggatgcgcagctgcccgaggcaccctggctggccgagattgatttcgtgatccggtcc
gaccgggcggagatggcgcggcaagcggcggcgcgggatatcgcgcccgtcgcgctggac
gatgcccaggtggcggatcttgtggccttcctgcacgcgctgaccgggcggacggcggag
gcgcggcccctcgggcggccggagacggtgccttcgggcctgccggttgactga

DBGET integrated database retrieval system