KEGG   Dinoroseobacter shibae: Dshi_2800Help
Entry
Dshi_2800         CDS       T00612                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
dsh  Dinoroseobacter shibae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dsh00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dsh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(2958766..2959473)
Genome map
AA seq 235 aa AA seqDB search
MQGKLTPLLWAAALVGLTGAAPADEIGDPERGAQLFRQCASCHQIGDGAESRVGPHLNEI
YGRRAGSIERFSYSDGMLRMGADGLIWDLRTLDAYIANPRALVSGTRMSYRGMPEAQDRA
DLLAYMRDFTASPADIPEAEPTALPSVPELPPDVLALQGDAEWGAYLSSECTSCHQIDGT
DQGIPSITYWPEEDFVLALHAYKTKLRPHPVMQMIAGRLSNEEIAALAAFFKDPD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtaagctgacacccctgctgtgggcggcggcgctggtcgggctgaccggtgcc
gcccccgcggacgaaatcggtgacccggagcgcggcgcgcaactctttcgccaatgcgca
agctgccaccagatcggcgacggcgccgaaagccgggtgggccctcacctgaacgagatc
tacggtcgccgcgccggcagcatcgaacggttcagctattccgacgggatgctgcgcatg
ggggcggacgggctgatctgggatctgcgcacgctcgacgcctatatcgccaacccccgc
gcgctggtatcgggcacccggatgagctaccgcggcatgccggaggcgcaggaccgcgcc
gaccttctggcttacatgcgcgacttcaccgccagtcccgccgacatccccgaggccgaa
ccgacagccctgccgtcggtgcccgagttgccgccggatgtgctggcgctgcaaggggat
gcggagtggggggcctatctttcgtccgaatgcacctcctgtcaccagattgacgggaca
gatcagggaattccctccattacctattggccggaagaggattttgtgctcgcattgcac
gcatacaagaccaagctgcgcccgcatccggtcatgcagatgatcgccggccggttgagc
aacgaggagattgccgcgctcgcagcctttttcaaggatcctgactag

DBGET integrated database retrieval system