KEGG   Dinoroseobacter shibae: Dshi_2866Help
Entry
Dshi_2866         CDS       T00612                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00020  Citrate cycle (TCA cycle)
dsh00190  Oxidative phosphorylation
dsh00650  Butanoate metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
dsh01200  Carbon metabolism
Module
dsh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dsh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dsh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dshi_2866
   00650 Butanoate metabolism
    Dshi_2866
  Energy metabolism
   00190 Oxidative phosphorylation
    Dshi_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABV94599
RoseoBase: Dshi_2866
UniProt: A8LJJ6
Position
complement(3023515..3023886)
Genome map
AA seq 123 aa AA seqDB search
MGFMTDRKRAMGLGSAKSGTEHHWHMQVSSVGLLILVPLFLFTFGRVVGAPYEEVIAYLA
RPFPAIVTALMLVVGFDHFRHGVTVAIEDYAQGTTRKALIIAMTCVSYGAMATGLFAIAR
LAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgggatttatgaccgaccgcaaacgcgccatgggtcttggctccgcgaaatccgggacc
gaacaccactggcacatgcaggtcagctccgtcgggctgctgatcctcgtgccgctcttt
ctgttcaccttcggccgagtcgtgggcgcgccttatgaagaggtgatcgcctatctcgca
cgtcccttcccggccatcgtcacggccctgatgctcgtcgtcggcttcgaccatttccgc
cacggcgtgaccgtcgcgatcgaggactacgcccaaggcaccacccggaaggcgctgata
attgcaatgacctgcgtgagctacggcgccatggccaccggcctattcgccattgcccgc
ctcgcgctgtga

DBGET integrated database retrieval system