KEGG   Dinoroseobacter shibae: Dshi_2866Help
Entry
Dshi_2866         CDS       T00612                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dsh  Dinoroseobacter shibae
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:dsh01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dsh00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dsh00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dsh00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(3023515..3023886)
Genome map
AA seq 123 aa AA seqDB search
MGFMTDRKRAMGLGSAKSGTEHHWHMQVSSVGLLILVPLFLFTFGRVVGAPYEEVIAYLA
RPFPAIVTALMLVVGFDHFRHGVTVAIEDYAQGTTRKALIIAMTCVSYGAMATGLFAIAR
LAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgggatttatgaccgaccgcaaacgcgccatgggtcttggctccgcgaaatccgggacc
gaacaccactggcacatgcaggtcagctccgtcgggctgctgatcctcgtgccgctcttt
ctgttcaccttcggccgagtcgtgggcgcgccttatgaagaggtgatcgcctatctcgca
cgtcccttcccggccatcgtcacggccctgatgctcgtcgtcggcttcgaccatttccgc
cacggcgtgaccgtcgcgatcgaggactacgcccaaggcaccacccggaaggcgctgata
attgcaatgacctgcgtgagctacggcgccatggccaccggcctattcgccattgcccgc
ctcgcgctgtga

DBGET integrated database retrieval system