KEGG   Dinoroseobacter shibae: Dshi_2878Help
Entry
Dshi_2878         CDS       T00612                                 

Gene name
sucC1
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00020  Citrate cycle (TCA cycle)
dsh00640  Propanoate metabolism
dsh00660  C5-Branched dibasic acid metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
dsh01130  Biosynthesis of antibiotics
dsh01200  Carbon metabolism
Module
dsh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dsh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dshi_2878 (sucC1)
   00640 Propanoate metabolism
    Dshi_2878 (sucC1)
   00660 C5-Branched dibasic acid metabolism
    Dshi_2878 (sucC1)
Enzymes [BR:dsh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dshi_2878 (sucC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Peptidase_S24 LEDGF
Motif
Other DBs
NCBI-ProteinID: ABV94611
RoseoBase: Dshi_2878
UniProt: A8LJK8
Position
3032211..3033404
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLRSYGAPVSDGRVVLRAEEAKTAAGEMDGPLWVVKAQIHAGGRGKGSFK
EADAGEKGGVRLAKSVEEAAEEAKKMLGRTLVTHQTGPAGKTVNRIYIEDGSGIETELYL
ALLVDRGTSRISFVCSTEGGMDIEEVAASTPEKILSFAVDPVTGYQPYHGRRIAFALGLS
GAQVKQCVKLMGQLYQCFVEKDMEMLEINPLIVTDSGDLKCLDAKMGFDGNAIYRHPDIA
ELRDETEEDPKELAASKYDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGSEPANFLDVG
GGATKEKVTEAFKIITSDPQVKGILVNIFGGIMRCDVIAEGVVAAVKEVGLQVPLVVRLE
GTNVEKGKEIINSSGLNVIAAENLRDGAEKIVAAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgagtaccaggcgaaagccctcctccgcagctacggcgcgccggtttcc
gatgggcgcgtggttctgagggccgaagaggccaagaccgccgccggcgagatggacggg
ccgctttgggtggtgaaggcgcagatccatgcgggcggacgcggcaagggctcgttcaag
gaagccgatgcaggcgagaagggcggcgtgcgcctggccaagtcggtcgaagaggccgcc
gaggaagccaagaagatgctgggccggacgctggtgacgcaccagaccgggcccgcgggc
aagaccgtcaaccgcatctatatcgaagacgggtcggggatcgagaccgagctctacctc
gccctgctggtggatcgcggcacgtcgcggatctcgttcgtctgctcgaccgagggcggc
atggatatcgaggaggtcgcagcctccacccccgaaaagatcctgtccttcgccgtggat
ccggtgaccggctatcaaccctatcacggccgccgcattgcctttgcgctcgggctgagc
ggcgcgcaggtcaagcaatgcgtcaagctgatgggccaactctaccagtgcttcgtcgag
aaggacatggagatgctggagatcaacccgctgatcgtgaccgacagtggcgatctgaaa
tgcctggacgcgaagatgggatttgacggcaacgcgatctatcgccacccggacatcgcc
gagttgcgcgacgagaccgaggaggatcccaaggagctcgccgcctcgaaatacgacctg
aactacatcgccctcgacggcgagatcggctgcatggtgaacggcgcgggcctcgccatg
gcgaccatggacatcatcaagctctacggttcggagcctgccaacttcctcgacgtgggc
ggcggtgcgaccaaggagaaggtgaccgaggcgttcaagatcatcacctcggacccgcag
gtcaaaggcatcctcgtgaacatcttcggcggcatcatgcgctgtgatgtgattgccgag
ggcgtggtggccgccgtgaaagaggtcggtctgcaagtgccgctggtggtgcgcctggag
gggacgaatgtcgagaagggcaaggagatcatcaactcctccggcctgaacgtcatcgcc
gccgagaaccttcgggacggcgccgagaagatcgtcgcagccgtcaagggctga

DBGET integrated database retrieval system