KEGG   Dinoroseobacter shibae: Dshi_2884Help
Entry
Dshi_2884         CDS       T00612                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dsh  Dinoroseobacter shibae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dshi_2884 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dshi_2884 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Dshi_2884 (sucB)
Enzymes [BR:dsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dshi_2884 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3039475..3040965
Genome map
AA seq 496 aa AA seqDB search
MSVEVRVPTLGESVTEATVATWFKKPGDTVAVDEMLCELETDKVTVEVPSPAAGTLAEIV
AAEGSTVGVDALLASIGEGSGAAAAEAAPAAPKAAPAESGGESVDVMVPTLGESVTEATV
STWFKKVGDTVVQDEMLCELETDKVSVEVPAPAAGVLTEILAPEGATVEASAKLAVLGGA
GAVAAPSEPAPAPAAPTAQGKDVEDAPSAKKLMAENNLASGDVQGTGRDGRVMKGDVLAA
LAAPKAAAPAPSAAPRAPVAAEDAAREERVKMTKLRQTIAKRLKDSQNTAAMLTTYNEVD
MTETMALRKEYKDLFEKKHGVRLGFMSFFTKACCHALKEVPEVNAEIDGTDIVYKNFVHM
GIAAGTPQGLVVPVIRDADRMSFAEIEAAIAEKGRRARDGKLSMAEMQGGTFTISNGGVY
GSLMSSPILNPPQSGILGMHKIQDRPMVINGEIKIRPMMYLALSYDHRIVDGKGAVTFLV
RVKEALEDPRRLLMDL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaagtccgcgtcccgacgctgggggaaagtgtcaccgaagccacggtggcc
acctggttcaagaagcccggcgataccgtcgcggtggacgagatgctctgcgagctggag
accgacaaggtgacggtggaggtcccctcccccgccgccggcaccctggccgaaatcgtc
gctgccgagggcagcaccgtgggcgtcgatgccctgctggcctcgatcggcgaaggctcc
ggcgcagcggcggccgaggcggcgccggcggccccgaaagcggccccggccgagagcggc
ggcgagagcgtcgacgtgatggtcccgaccctgggcgagagcgtgaccgaggccacggtg
tcgacctggttcaagaaggtcggtgacacggttgtccaggacgagatgctgtgcgagctg
gaaaccgacaaggtgtcggtcgaggtgcctgccccggcggcgggtgttctgaccgagatc
ctggcgcccgagggcgccacggtggaggcctcggccaagctcgccgtgctcggcggggcc
ggcgcggtcgcggccccttcggaaccggctcccgcaccggcggcgcccaccgcccagggc
aaagatgtggaggacgcgccctcggccaagaagctgatggcggagaacaaccttgcctct
ggcgatgttcagggcacgggccgcgacgggcgcgtgatgaagggcgacgtgctggccgca
ctggccgcaccgaaagccgccgccccggccccgtccgccgccccgcgcgccccggtggcc
gccgaggacgcggcgcgcgaagagcgggtcaaaatgaccaagctgcgccagaccatcgcc
aagcgcctgaaggacagccagaacaccgccgcgatgctcaccacctacaacgaggtggac
atgaccgagaccatggcgctccggaaagagtacaaggacctgttcgagaagaaacacggc
gttcgcctaggcttcatgtccttcttcaccaaggcctgctgtcatgccctgaaggaggtg
cccgaggtcaatgccgagatcgacggcaccgacatcgtctacaagaacttcgtccatatg
ggcatcgccgcgggcacgccccagggcctcgtggtgccagtgatccgggacgcggaccgc
atgagctttgccgagatcgaggcggccatcgccgaaaagggccgccgcgcccgggacggc
aagctcagcatggccgagatgcagggcgggaccttcacgatctcgaacggcggggtctac
ggctcgctgatgtcttcgccgatcctgaacccgccgcagtcgggcatcctcggcatgcac
aagatccaggaccgcccgatggtcatcaacggcgaaatcaagatccgcccgatgatgtac
ctggccctcagctacgaccaccggatcgtggacggcaaaggggcggtgaccttcctcgtg
cgcgtgaaagaggcgctggaggatccccggcggctgctgatggatttgtaa

DBGET integrated database retrieval system