KEGG   Dinoroseobacter shibae: Dshi_3000Help
Entry
Dshi_3000         CDS       T00612                                 

Gene name
mcd
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dsh  Dinoroseobacter shibae
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dshi_3000 (mcd)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dshi_3000 (mcd)
Enzymes [BR:dsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Dshi_3000 (mcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(3166482..3167735)
Genome map
AA seq 417 aa AA seqDB search
MSVMADLLGTLFERRYRAGAPDPRALPELSRALVEARAEGPGGELARALLDRYAAAERDE
RLAWFTFLAEEMDLDTAALTDALATYAEDSDPEAYRRLAALSEPPRQELARRLNQVPGAT
AQLVAMRADLLSMIPDAPGLQRVDLDFRHLFKSWFNRGFLVLRPITWESPAHILEKIIAY
EAVHEIHSWDDLRRRLEPADRRCFAFFHPSMPDEPLIFVEVALTTAVPGSIQALLSEDRA
QIDPGQATTATFYSISNCQDGLAGISFGNFLIKQVVRDLQRDLPQITRFVTLSPIPGLCA
WTAETGLDWPDDGAAQAALAAHYLLKAKGRGTAPRDPVARFHLGNGALVHAVHSGADTSD
NGRRQSGGVMVNYLYDLDRIAENHARFHDDGTIAASRDMVSLAKRAPMPRLEQTETT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgtgatggccgaccttctcggcacgctcttcgagcggcgctaccgcgcgggggcc
ccggatccgcgcgccctgccagagctgtcccgcgcgctggtagaggcgcgggccgaaggg
ccggggggcgagttggcaagggcgcttctggaccgctatgccgccgcggagcgggatgaa
cgtctggcctggttcaccttcctggccgaggaaatggatctcgacaccgccgccctgacc
gacgcgctggccacctatgccgaggacagtgacccggaggcctatcgccgcctcgcagcc
ctctccgaacccccgcggcaggagcttgcccgccgcctcaaccaagtgcccggggccacg
gcgcaactggtggcgatgcgcgccgacctgctgagcatgatccccgacgccccgggcctg
caacgcgtggacctggacttccgtcacctgttcaagagctggttcaaccgcggctttctg
gtgctgcgcccgataacctgggaaagcccggcccatatcctggagaagatcatcgcctac
gaggcggtgcatgaaatccactcctgggatgacctgcggcggcggctggagcctgcggac
cgccgctgctttgccttctttcacccctccatgcccgacgagccgctgatcttcgtcgag
gtcgccctgaccaccgcggtgcccggctcgatccaggcgcttctgtccgaggaccgcgcg
cagatcgacccgggccaggccaccaccgcgaccttctactcgatctcgaactgccaggac
gggctggcgggcatctccttcggcaatttcctgatcaagcaggtggtccgcgacctgcaa
cgcgacctgccccagatcacccgcttcgtcaccctctcgccgatcccgggcctgtgcgcc
tggacagccgagaccggcctcgactggcccgacgatggcgccgcccaggccgcgctcgcc
gcccattacctgctgaaggccaagggccgtggcacagccccacgcgacccggtggcgcgc
ttccacctgggcaacggcgcgctggtccatgcggtccattcgggggccgatacctccgac
aatggccgacgccaatcgggcggtgtcatggtgaactacctttacgacctcgaccggatc
gccgaaaaccacgccaggttccacgatgacggcaccatcgccgccagccgcgatatggtc
agcctcgccaagcgcgcgcccatgccgagactcgagcagacggagacgacctga

DBGET integrated database retrieval system