KEGG   Dinoroseobacter shibae: Dshi_3020Help
Entry
Dshi_3020         CDS       T00612                                 

Gene name
dapE2
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dsh  Dinoroseobacter shibae
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dsh01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dsh00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3189351..3190646
Genome map
AA seq 431 aa AA seqDB search
MPDETSLTDAVSARRADLVALTRDLIRIPTLNPPGRHYHDICAFLEARLAPLGFRCELVR
ATGAPADSERYPRWNLVARYEGGGPGDCVHFNSHHDVVEVGHGWTMDPFGGEVRDGRVYG
RGACDMKGGLAASVIAAEAFIATHPEFSGAIEISATADEESGGFGGVAYLAEQGWFSPER
VQHVIIPEPLNKDRICLGHRGVWWAEVETKGRIAHGSMPFLGDSAIRHMGAVLHEIETVL
YPLLATKRTKMPVVPEGARQSTLNINSVHGGEPEQDADYTGLPAPCVADRCRIVLDRRFL
IEEDITEVKAEITALLERVKATRPSFEYEIRELFEVQPTMADRDAPVVRSVAASIERVLA
RQPDYVVSPGTYDQKHIDRIGRLKNCIAYGPGILDLAHQPDEWVGIDDMVDSAKVMALTL
QDLLVVPQPGS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgaaacctccctgaccgatgcggtgagcgcccggcgcgccgatctggtggcg
ctgacccgggatctgatccggatcccgaccctgaacccgcctggccggcactatcacgac
atctgtgcctttctggaggcacgactcgcgcctctggggttccggtgcgagctggtgcgc
gccacgggtgcccccgccgacagcgaacgctacccccgctggaacctcgtggcacgctac
gagggcgggggcccgggcgactgcgtgcatttcaattcgcaccatgacgtggtggaggtg
ggccatggctggaccatggacccgttcggcggggaggtgcgggacggccgcgtctatggc
cgcggggcctgcgacatgaagggcgggctggccgcctcggtcatcgcggcggaggcgttc
atcgccacccacccggagttttccggcgccatcgagatcagtgccaccgcggacgaggaa
tcgggcggcttcggcggggtggcgtacctcgctgaacagggctggttctcgcctgagcgt
gtgcagcatgtgatcatccccgagccgctcaacaaggaccgcatctgcctcggccatcgc
ggcgtctggtgggcggaggtcgagaccaagggccggatcgcccatggctccatgccgttt
ctgggcgacagcgcgatccgccacatgggcgcggtgctgcacgagatcgagacggtgctc
tatcccctgctcgccaccaagcgcaccaagatgcccgtggtgcccgagggcgcgcgacag
tccaccctgaacatcaattctgtccatggcggcgaaccggagcaggacgcggattacacc
ggcctgcccgcgccctgcgtcgcggaccgctgccggatcgtgctcgatcggcggtttttg
atcgaagaggacatcacggaggtgaaggccgagatcacggcgctgctggagcgggtgaag
gccacccgacccagtttcgagtacgagatccgcgagcttttcgaggtgcagcccaccatg
gcggaccgggacgcgcccgtggtccgctcggtcgcggcgtccatcgagcgggtgctggcg
cggcagccggattacgtggtcagcccgggcacctatgaccagaaacatatcgaccggatc
gggcggctgaagaactgcatcgcgtatgggccggggatcctcgacctggcccaccagccg
gacgaatgggtggggatcgacgacatggtcgacagcgccaaggtgatggccctgacgctg
caggacctgcttgtggtgccgcagccgggttcgtaa

DBGET integrated database retrieval system