KEGG   Dinoroseobacter shibae: Dshi_3073Help
Entry
Dshi_3073         CDS       T00612                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00900  Terpenoid backbone biosynthesis
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01130  Biosynthesis of antibiotics
Module
dsh_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dshi_3073 (ispE)
Enzymes [BR:dsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dshi_3073 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABV94806
RoseoBase: Dshi_3073
UniProt: A8LL57
Position
complement(3240124..3240987)
Genome map
AA seq 287 aa AA seqDB search
MSPPTEGRAPGSRPIAGFAPAKINLTLHVTGQRGDGYHLLDSLVVFADIGDRLVLDPDAA
LGLTVSGPRAAGVPTGPENLILKAAAHLGAVRGAIHLEKHLPAAAGIGGGSSDAATALRL
HAQAMGRALPDDGAALGADVPVCLRGKATRMSGIGEALTPVAGLPPLPAVLVNPGVDVPT
PAVFRGLRQKENPPMPADLPGFATPTDCARWLATQRNDLEPPARAAAPVIDSVLAEIAGD
PDCLLARMSGSGATCFGLFETPAQAQAAAETLSTRHPDWWVAPTVLR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaccgactgaggggcgcgccccggggtcgcgaccgatcgcgggctttgccccg
gcgaagatcaacctgaccctgcatgtcaccgggcagcggggcgatggctatcacctgctc
gacagcctcgtggtcttcgccgatatcggcgaccggctggtgctcgaccccgacgcggcc
ctcgggctgaccgtgtcgggcccgcgcgcggcgggcgtgcccacggggcccgaaaacctg
atcctgaaggccgcggcccatctcggggcggtgcgcggtgcgatccatctggaaaaacac
ctgcccgcggcggcggggatcggtggcgggtcctccgatgccgcgaccgcgctccggctc
catgcgcaggcgatgggccgcgcgctgcccgacgatggcgcggcccttggtgccgacgtg
cccgtctgcctgcgagggaaggcgacccgcatgtccgggatcggcgaagcgctcaccccc
gtggcgggtctgccgccgctgcccgcggtgctggtcaaccctggcgtggacgtgccgacc
ccggccgtgttcaggggcctgcgtcaaaaggaaaatccgcccatgcccgccgacctgccc
ggctttgcaacgccgaccgattgcgcccgatggctcgccacccagcgcaacgacctggag
ccgcccgcccgcgccgcggcccccgtgatcgacagcgttctggcggagatcgcgggcgat
ccggactgcctgctggcccggatgtccggctccggcgcgacctgtttcggtctcttcgaa
acccctgcacaggcgcaggcggcggcggaaaccctctcaacccggcacccggactggtgg
gtcgcgccgaccgtgctcaggtga

DBGET integrated database retrieval system