KEGG   Dinoroseobacter shibae: Dshi_3091Help
Entry
Dshi_3091         CDS       T00612                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00240  Pyrimidine metabolism
dsh00250  Alanine, aspartate and glutamate metabolism
dsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dshi_3091 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dshi_3091 (pyrB)
Enzymes [BR:dsh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dshi_3091 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABV94824
RoseoBase: Dshi_3091
UniProt: A8LL75
Position
3260134..3261084
Genome map
AA seq 316 aa AA seqDB search
MTLRARHLLGIEHLAPDEIVTLLDLADRYADLNRRPDKHGDALDGLTQINMFFENSTRTQ
ASFEIAGKRLGADVMNMEVRASSIKKGETLIDTAMTLNAMHPDLLVVRHPHSGAVNLLAE
KVNCAVLNAGDGRHEHPTQALLDALTIRRAKGKLHRLNVAICGDIAHSRVARSNILLLGK
MENRIRLVGPRTLMPAEIAELGVEVYEDMKAGLDGVDVVMMLRLQKERMDGGFIPSEREY
YHRYGLDAEKLAYAKPDAIVMHPGPMNRGVEIDGTLADDINRSVIQEQVEMGVAVRMAAM
DLLARNLRAAREGVRA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacactccgcgcgcgtcatcttctggggatcgaacacctggccccggacgagatcgtc
acgctgctggacctcgcggatcgctacgcagacctgaaccgacgcccggacaagcatggc
gacgcgctggacgggctcacccagatcaacatgttcttcgaaaactccacccgcacccag
gccagtttcgagatcgcgggcaagcggctcggcgcggacgtgatgaacatggaagtgcgc
gccagctcgatcaagaagggcgagaccctgatcgacacggcgatgaccctgaacgccatg
cacccggatctgctggtcgtccgacatccccattccggggcggtcaacctcctggcggaa
aaggtgaattgcgcggttctgaacgcaggcgatgggcggcatgagcatccgacgcaagcc
ctgctcgatgcgctgacgatccggcgcgccaagggcaagctgcaccggctcaacgttgcg
atctgcggcgacatcgcccattcccgggtcgcgcgctccaacatcctgctgctgggcaag
atggagaaccgcatccgcctcgtggggccgcggaccctgatgcccgccgagatcgccgag
cttggcgtcgaggtgtacgaggacatgaaggccgggctggacggggtcgacgtggtgatg
atgctgcggctccagaaggagcggatggatggcggtttcatcccgtcggagcgcgaatat
taccaccgctacgggctggatgccgagaagctcgcctatgccaagcccgacgccatcgtc
atgcatcccggcccgatgaatcgcggggtcgagatcgacggcaccctggccgacgacatc
aaccgctccgtcatccaggagcaggtcgagatgggcgtggccgtgcgcatggcggcgatg
gacctgctggcgcgcaacctgcgcgccgcacgagaaggagttcgcgcatga

DBGET integrated database retrieval system