KEGG   Dinoroseobacter shibae: Dshi_3169Help
Entry
Dshi_3169         CDS       T00612                                 

Gene name
cycA1
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
dsh  Dinoroseobacter shibae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dshi_3169 (cycA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dshi_3169 (cycA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3333379..3333759
Genome map
AA seq 126 aa AA seqDB search
MLIRTITTTAVLAVLALPALAEGDPEAGEKVFNKCKACHALGADAKNKVGPVLNGIIGAP
AGQVPDFKYSDVLLEMAADGLVWDEANLAAYLTKPRDFMKGTKMSFAGLRKEADVQNVLA
YIASYE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcagaacgatcacaaccaccgccgtcctggccgtgcttgcccttccggccctg
gccgaaggcgacccggaagccggagagaaggtgttcaacaagtgcaaggcctgccatgct
cttggcgccgatgccaagaacaaggtcgggccggtcctgaacgggatcatcggcgcgccc
gccggccaggtcccggacttcaagtattccgacgtgttgttggagatggccgccgacggg
ctggtctgggacgaagccaacctggccgcctacctgaccaagccgcgcgacttcatgaaa
ggcaccaagatgtcttttgccggtctgcgcaaggaagcggatgtccagaacgtcctggcg
tacatcgcaagctacgagtga

DBGET integrated database retrieval system