KEGG   Dinoroseobacter shibae: Dshi_3194Help
Entry
Dshi_3194         CDS       T00612                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
dsh  Dinoroseobacter shibae
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:dsh00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
3358128..3360071
Genome map
AA seq 647 aa AA seqDB search
MTDKTPKGGISRRGLLGATAGGAALAGTYGGRAMLAGGALGAATAASTTKASAAAESTHV
APGQLDEYYGFWSSGQTGEVRIIGVPSMRELMRIPVFNICSATGWGITNESKKILTEGLT
EKTKKYLAANGLEFPRNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARIRCDVMKCDKI
IEIPNAKGIHGLRPQKWPRTNYVFANGEDEVPIVNDGQILDKPEEYTNFYTALNADEMTV
AWQVMVTGNLDNTDADYEGKYAFSTSYNSEMGMTLADMTESDMDHVVVFNIAEIEKGIAE
GDYIELNGVKVIDGRKGSNKKYTRYIPIPNNPHGCNMAPDKVHLCIGGKLSPTVSVIDVR
KLDALFEEDADPRSAVVAEPELGLGPLHTCFDGKGRAYTTLFLDSQVVQWDIAKAVEAYG
GADVNPILSKTDVHYQPGHNSTAEGETLDASDKFYITMNKFSKDRFLNVGPLKPENEQVF
VIDDTKLTLVHDGPTFAEPHDSIIVHPSKVNPVSVWDRNDPMWAETRRQAEADGIDLDDW
QEEVIRDGNKVRVYMTSQAPNFSLETFTVTEGDEVTVTVTNLDDIDDLTHGFTMGNHGVA
MELGPQATASVTFTAAQPGVYWYYCQWFCHALHMEMRGRMFVEPRDA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaagacacccaaaggcgggatctcccgcagaggccttctgggcgcaaccgcc
ggaggcgcggctctggccggaacctatggcgggcgggccatgcttgccggcggcgccctc
ggtgcggcgaccgcagcctcgaccaccaaggccagcgcggccgccgagtccacccacgtg
gccccgggccagctggacgaatattacggcttctggtcctcgggccagaccggcgaggtg
cgcatcatcggcgtgccctccatgcgcgagctgatgcggatccctgttttcaacatctgc
tcggccaccggctggggcatcaccaacgagtccaagaagatcctgaccgagggcctgacg
gagaaaaccaagaagtacctcgctgccaacgggctggaattcccgcgcaacggcgatctg
caccacgtccacatgtccttcaccgaaggcaagtatgacgggcgcttcctgttcatgaac
gacaaggccaacacccgcgtggcccggatccgttgcgacgtgatgaaatgcgacaagatc
atcgagatcccgaacgccaagggtatccacggcctgcgtccgcagaaatggccgcgcacc
aactacgtgttcgccaatggcgaggacgaggtgccgatcgtcaatgacggccagatcctg
gacaagcccgaggagtacaccaacttctacaccgccctgaacgccgatgagatgaccgtc
gcttggcaggtcatggtgaccggcaacctcgacaacaccgatgcggattacgagggcaag
tacgccttctcgacctcctacaactcggaaatgggcatgactctcgcggacatgaccgaa
tccgacatggaccacgtggtggtgttcaacatcgccgagatcgagaagggcatcgccgag
ggcgactatatcgagttgaacggcgtcaaggtcatcgacgggcgcaagggatcgaacaag
aaatacacccgctacatcccgatccccaacaacccccatggctgcaacatggcgccggac
aaggtgcacctgtgcatcggcggcaagctgtcgcccacggtttcggtgatcgacgtgcgc
aagctcgacgcgctgttcgaagaggatgccgatccgcgctcggcagtcgtggcagagccg
gagctgggcctcggcccgcttcacacctgctttgacgggaagggccgggcctataccacg
ctcttcctcgacagccaggtggtgcaatgggacatcgccaaggccgttgaggcctatggc
ggcgccgacgtgaacccgatcctgtccaagacggatgtgcactaccagccgggccacaac
tccaccgccgagggcgaaaccctcgacgcatcggacaagttctacatcacgatgaacaag
ttctcgaaggaccgcttcctgaatgtcggcccgctcaagcccgagaacgagcaggtcttc
gtgatcgacgacaccaagctgacactggtccatgacggcccgaccttcgccgagccccat
gacagcatcatcgtccatccctccaaggtgaacccggtttcggtctgggatcggaacgac
ccgatgtgggccgaaacccgccggcaagccgaggccgatggaatcgatctcgatgactgg
caggaggaagtgatccgcgacggcaacaaggtccgggtctacatgaccagccaggcaccg
aacttctcgctggaaaccttcacggtgaccgagggcgacgaggtgacggtgacggtcacc
aatctcgacgatatcgacgacctgacccacggcttcaccatgggcaaccacggcgtcgcg
atggaactcgggccccaggcgaccgcatcggtgaccttcaccgccgcccagcccggcgtc
tactggtactactgccagtggttctgccacgcgctccacatggagatgcgcggccggatg
ttcgtcgaaccgcgggacgcctga

DBGET integrated database retrieval system