KEGG   Dinoroseobacter shibae: Dshi_3295Help
Entry
Dshi_3295         CDS       T00612                                 

Gene name
ispA
Definition
geranyltranstransferase (EC:2.5.1.10)
Orthology
K00795  
farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
dsh  Dinoroseobacter shibae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C10-C20 isoprenoid biosynthesis, bacteria
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dsh00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(3461924..3462799)
Genome map
AA seq 291 aa AA seqDB search
MSGFAAAQADGATRIAACLDDLIGAQPESVIRDGMAYATRGGKRLRGVLVLETAWLHGVA
PERAVYAAAAIECLHAYSLVHDDLPAMDDDDLRRGQPTVHVKWDEASAILVGDALQTLAF
EALSDPRMTDDPAVALALVRSLAQASGAAGMVLGQALDIAAETAAAPLSLDEITRLQAGK
TGALIRWSAEAGALLARADPAPLRRYAEAIGLAFQIADDILDVTGDAEKAGKRLQKDAEA
GKATFVSLLGLEAARARAAALVAEAEAALQPYGAEAETLCELARFVIARDT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgtcggggtttgcagcggcccaagccgacggggccacacggattgccgcctgtcttgac
gatctgatcggagctcagcccgagagcgttatccgcgacgggatggcctatgccacccgg
ggcggcaagcggttgcgcggagtgctggtgctggagacggcctggctgcacggtgtggcg
ccggagcgggcggtttacgccgccgccgccatcgagtgcctgcatgcctattccctggtc
catgacgacctgcctgcgatggatgatgacgatctgcgccggggtcagcccacggtgcac
gtcaaatgggacgaggcgagcgcgatcctcgtgggcgatgccttgcagaccctggccttc
gaggcgctgagcgatccgcgcatgaccgacgatccggccgtggcgctggcgctggtgcgg
tccctcgcacaggcctccggggcggcgggcatggtgctgggccaggcgctggacatcgcg
gccgagactgcggcggcccccctgagcctcgacgagatcacccggttgcaggcgggcaag
accggcgcgctgatccgctggtcggcggaggcgggcgcgctgctggcccgggcggacccg
gcccccctgcggcggtatgccgaggccatcggccttgccttccagatcgcggatgacatc
ttggacgtcacgggcgatgctgaaaaagcgggcaaacggctacagaaggatgccgaggcg
ggcaaggcgaccttcgtgtcgctcttggggctggaggcggcgcgggcgcgggcggcggcg
ctggtggcagaggccgaggcggcgttgcagccctatggcgcggaggcagagaccttgtgc
gagctggcgcgtttcgttatcgcacgcgacacctga

DBGET integrated database retrieval system