KEGG   Dinoroseobacter shibae: Dshi_3347Help
Entry
Dshi_3347         CDS       T00612                                 

Gene name
pncA
Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
dsh  Dinoroseobacter shibae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Dshi_3347 (pncA)
Enzymes [BR:dsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Dshi_3347 (pncA)
    3.5.1.-  
     Dshi_3347 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RoseoBase: 
UniProt: 
Position
complement(3515388..3515990)
Genome map
AA seq 200 aa AA seqDB search
MTHALIVIDVQNDFCPGGALAVAEGNTIVPAINALMAEAEAVVLTQDWHPAGHSSFASSH
PGAAPLSMIDMPYGPQVLWPDHCVQGSDGAAFHPDLDTTRADMIVRKGFRPAIDSYSAFF
ENDHETPTGLDGYLRSRGITDLTLVGLATDFCVHYSAVDAAKLGFAVTVRTDLCRAIDLD
GSLASACTAMQEAGVRLSDV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgccctgatcgtcatcgatgtgcaaaacgatttctgtcccggcggcgcgctt
gcggtggccgaaggcaataccatcgtgcccgccatcaacgccctgatggctgaggccgaa
gcggtggtgctcacccaggattggcacccggcgggtcacagttcttttgccagtagtcat
cccggagccgctcccctgtcgatgatcgatatgccctatggcccgcaggtcctttggccg
gaccattgcgtacaaggcagtgacggggcggcatttcaccccgatctggatacgacccgt
gccgacatgatcgtgcgcaaggggtttcgcccggccatcgacagttattctgcgttcttc
gagaacgatcatgaaactccaacggggcttgacgggtatctgcgcagccgcggcatcacg
gacctgacgctggtggggctcgccacggatttctgtgtgcattactcggcggtggatgcg
gccaaactgggctttgccgtcactgttcgcaccgacctgtgccgcgccatcgacctcgac
ggctcgctggcatccgcctgcaccgcgatgcaggaggccggcgtgcgtctctcggacgtg
tga

DBGET integrated database retrieval system