KEGG   Dinoroseobacter shibae: Dshi_3416Help
Entry
Dshi_3416         CDS       T00612                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dsh  Dinoroseobacter shibae
Pathway
dsh00860  Porphyrin and chlorophyll metabolism
dsh01100  Metabolic pathways
dsh01110  Biosynthesis of secondary metabolites
dsh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dshi_3416 (hemD)
Enzymes [BR:dsh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dshi_3416 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABV95149
RoseoBase: Dshi_3416
UniProt: A8LP84
Position
3594171..3594887
Genome map
AA seq 238 aa AA seqDB search
MVTQPPLPVLLTRPRAQSEQFAATLPPVLRPVISPLLHILHLDDLPPAPETATLIFTSGN
GVTAYATQHPGIGQSALCVGTKTTAIARDLGFDAISAEGDARAILDLAAAYPGPFVHVRG
KHTTGDIAGALRDLGKEVAEIIAYDQTPVELSETARAILEGPCAVPLFSPRTACLFTNAC
PTARTAQIIAMSPAVAEQLPEHAYSGISILEKPNAAAMRDALLAYAGGNHLEAGRTSG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggtcacacaaccgccgctgcctgttctgctcacgcgcccacgggcgcaatcggaacag
tttgctgcgacgttgccgcctgtcctgcggcctgtcatctccccgctgctgcacatcctt
catctcgacgatttgccgccagcccccgagacagcgacgctcatctttacctccggcaat
ggtgtcacggcctatgcgacgcaacacccgggcattgggcagtccgcgctctgcgtcggg
acaaagacgactgcgatcgcgcgcgatctggggttcgacgccatctcggcggagggggac
gcccgtgccattctggacctcgccgctgcataccccgggcccttcgtccatgttcgcggc
aagcatacgaccggcgatattgcgggcgcattgcgtgatctgggcaaggaggttgcagag
atcatcgcctatgatcagacgcccgttgagctgagcgaaacggcgcgcgcaatcctcgaa
ggaccctgcgccgtgccacttttctcgccccgaacggcctgcttgttcactaacgcctgc
ccgacggcccgcacagcgcagatcatcgcaatgagcccagcggttgcagaacaactcccc
gaacacgcctatagcgggataagtatcctcgaaaagcccaatgctgcggcaatgcgggac
gctcttttggcatatgcagggggcaatcatcttgaggcgggcaggacctctggctag

DBGET integrated database retrieval system